• Gene id: 8031

Gene Summary

• Gene Symbol: NCOA4   Gene   UCSC   Ensembl
• Aliases: ARA70, ELE1, PTC3, RFG
• Gene name: nuclear receptor coactivator 4
• Alternate names: nuclear receptor coactivator 4, 70 kDa AR-activator, 70 kDa androgen receptor coactivator, NCoA-4, RET-activating gene ELE1, androgen receptor-associated protein of 70 kDa, ret fused,
• Gene location: 10q11.22 (46030713: 46005087)     Exons: 14     NC_000010.11
• Gene summary(Entrez): This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gen
• OMIM: 601984

Protein Summary

• Protein general information: Q13772  
  • Name: Nuclear receptor coactivator 4 (NCoA 4) (Androgen receptor coactivator 70 kDa protein) (70 kDa AR activator) (70 kDa androgen receptor coactivator) (Androgen receptor associated protein of 70 kDa) (Ret activating protein ELE1)
  • Length: 614  
  • Mass: 69726
  • Tissue specificity: Widely expressed. Also detected in adipose tissues and in different cell lines. Isoform Beta is only expressed in testis.
• Sequence:

  MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWLYEQVD
  LIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLFEADTITLRQT
  ITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKPASGYQAPYIPSTDPQ
  DWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSSFSIEMEKVGDQELPDQDEMD
  LSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNCQGNQPKGVEIENLGNLKCLNDHLEA
  KKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDENCEKEALYKWLLKKEGKDKNGMPVEPKPEP
  EKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIKNSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKS
  PMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWLLRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLK
  VDKEKWLYRTPLQM

• Structural information:
  • Interpro: IPR022174  IPR039947  
  • PDB: 1T5Z
  • PDBsum: 1T5Z
  • DIP: 5957
  • STRING: ENSP00000463027
• Other Databases: GeneCards:  NCOA4  Malacards:  NCOA4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009725	response to hormone	IBA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process
GO:0003713	transcription coactivator activity	IEA	molecular function
GO:0003713	transcription coactivator activity	TAS	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0008584	male gonad development	TAS	biological process
GO:0044754	autolysosome	IDA	cellular component
GO:0006622	protein targeting to lysosome	IDA	biological process
GO:0009725	response to hormone	IEA	biological process
GO:0006879	cellular iron ion homeostasis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04216	Ferroptosis
hsa05216	Thyroid cancer

Diseases

Associated diseases	References
Thyroid cancer	KEGG:H00032
Thyroid cancer	KEGG:H00032
Prostate cancer	PMID:15166229
Prostate cancer	PMID:12368219
Polycystic ovary syndrome	PMID:16580389
invasive ductal carcinoma	PMID:11561770
ovarian carcinoma	PMID:11161850
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray