• Gene id: 80308

Gene Summary

• Gene Symbol: FLAD1   Gene   UCSC   Ensembl
• Aliases: FAD1, FADS, LSMFLAD, PP591
• Gene name: flavin adenine dinucleotide synthetase 1
• Alternate names: FAD synthase, FAD pyrophosphorylase, FAD-synthetase, FMN adenylyltransferase, Fad1, flavin adenine dinucleotide synthetase, homolog,
• Gene location: 1q21.3 (154983343: 154993110)     Exons: 7     NC_000001.11
• Gene summary(Entrez): This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 20
• OMIM: 608315

Protein Summary

• Protein general information: Q8NFF5  
  • Name: FAD synthase (EC 2.7.7.2) (FAD pyrophosphorylase) (FMN adenylyltransferase) (Flavin adenine dinucleotide synthase) [Includes: Molybdenum cofactor biosynthesis protein like region; FAD synthase region]
  • Length: 587  
  • Mass: 65266
• Sequence:

  MGWDLGTRLFQRQEQRSRLSRIWLEKTRVFLEGSTRTPALPHCLFWLLQVPSTQDPLFPGYGPQCPVDLAGPPCL
  RPLFGGLGGYWRALQRGREGRTMTSRASELSPGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVS
  VVPDEVATIAAEVTSFSNRFTHVLTAGGIGPTHDDVTFEAVAQAFGDELKPHPKLEAATKALGGEGWEKLSLVPS
  SARLHYGTDPCTGQPFRFPLVSVRNVYLFPGIPELLRRVLEGMKGLFQNPAVQFHSKELYVAADEASIAPILAEA
  QAHFGRRLGLGSYPDWGSNYYQVKLTLDSEEEGPLEECLAYLTARLPQGSLVPYMPNAVEQASEAVYKLAESGSS
  LGKKVAGALQTIETSLAQYSLTQLCVGFNGGKDCTALLHLFHAAVQRKLPDVPNPLQILYIRSISPFPELEQFLQ
  DTIKRYNLQMLEAEGSMKQALGELQARHPQLEAVLMGTRRTDPYSCSLCPFSPTDPGWPAFMRINPLLDWTYRDI
  WDFLRQLFVPYCILYDRGYTSLGSRENTVRNPALKCLSPGGHPTYRPAYLLENEEEERNSRT

• Structural information:
  • Interpro: IPR012183  IPR036425  IPR001453  IPR002500  IPR014729  
  • CDD: cd00885 cd01713
  • STRING: ENSP00000292180
• Other Databases: GeneCards:  FLAD1  Malacards:  FLAD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003919	FMN adenylyltransferase activity	IBA	molecular function
GO:0006747	FAD biosynthetic process	IBA	biological process
GO:0003919	FMN adenylyltransferase activity	IEA	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0006747	FAD biosynthetic process	IEA	biological process
GO:0016779	nucleotidyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003919	FMN adenylyltransferase activity	IEA	molecular function
GO:0003919	FMN adenylyltransferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0006771	riboflavin metabolic process	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0006747	FAD biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00740	Riboflavin metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray