• Gene id: 80306

Gene Summary

• Gene Symbol: MED28   Gene   UCSC   Ensembl
• Aliases: 1500003D12Rik, EG1, magicin
• Gene name: mediator complex subunit 28
• Alternate names: mediator of RNA polymerase II transcription subunit 28, endothelial-derived gene 1, endothelial-derived protein 1, mediator of RNA polymerase II transcription, subunit 28 homolog, merlin and Grb2-interacting cytoskeletal protein, tumor angiogenesis marker EG-1,
• Gene location: 4p15.32 (17614640: 17634104)     Exons: 4     NC_000004.12
• OMIM: 610311

Protein Summary

• Protein general information: Q9H204  
  • Name: Mediator of RNA polymerase II transcription subunit 28 (Endothelial derived protein 1) (Mediator complex subunit 28) (Merlin and Grb2 interacting cytoskeletal protein) (Magicin) (Tumor angiogenesis marker EG 1)
  • Length: 178  
  • Mass: 19520
  • Tissue specificity: Widely expressed. Highly expressed in vascular tissues such as placenta, testis and liver. {ECO
• Sequence:

  MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSSSTLVDELESSFEACFASLVSQDYVNGTDQEEIRT
  GVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQH
  KKPADIPQGSLAYLEQASANIPAPLKPT

• Structural information:
  • Interpro: IPR021640  
  • STRING: ENSP00000237380
• Other Databases: GeneCards:  MED28  Malacards:  MED28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016592	mediator complex	IBA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051151	negative regulation of smooth muscle cell differentiation	IEA	biological process
GO:0030864	cortical actin cytoskeleton	IEA	cellular component
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)