• Gene id: 80279

Gene Summary

• Gene Symbol: CDK5RAP3   Gene   UCSC   Ensembl
• Aliases: C53, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114, PP1553
• Gene name: CDK5 regulatory subunit associated protein 3
• Alternate names: CDK5 regulatory subunit-associated protein 3, CDK5 regulatory subunit associated protein IC53-2, LXXLL/leucine-zipper-containing ARF-binding protein, LXXLL/leucine-zipper-containing ARFbinding protein, ischemic heart CDK5 activator-binding protein C53,
• Gene location: 17q21.32 (74584678: 74594208)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene encodes a protein that has been reported to function in signaling pathways governing transcriptional regulation and cell cycle progression. It may play a role in tumorigenesis and metastasis. A pseudogene of this gene is located on the long arm
• OMIM: 608202

Protein Summary

• Protein general information: Q96JB5  
  • Name: CDK5 regulatory subunit associated protein 3 (CDK5 activator binding protein C53) (LXXLL/leucine zipper containing ARF binding protein) (Protein HSF 27)
  • Length: 506  
  • Mass: 56921
  • Tissue specificity: Ubiquitously expressed (PubMed
• Sequence:

  MEDHQHVPIDIQTSKLLDWLVDRRHCSLKWQSLVLTIREKINAAIQDMPESEEIAQLLSGSYIHYFHCLRILDLL
  KGTEASTKNIFGRYSSQRMKDWQEIIALYEKDNTYLVELSSLLVRNVNYEIPSLKKQIAKCQQLQQEYSRKEEEC
  QAGAAEMREQFYHSCKQYGITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLP
  MLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQVAEDAIDWGDFGVEAVSEGTDSGISAEAAGIDWGIFPES
  DSKDPGGDGIDWGDDAVALQITVLEAGTQAPEGVARGPDALTLLEYTETRNQFLDELMELEIFLAQRAVELSEEA
  DVLSVSQFQLAPAILQGQTKEKMVTMVSVLEDLIGKLTSLQLQHLFMILASPRYVDRVTEFLQQKLKQSQLLALK
  KELMVQKQQEALEEQAALEPKLDLLLEKTKELQKLIEADISKRYSGRPVNLMGTSL

• Structural information:
  • Interpro: IPR008491  
  • STRING: ENSP00000438886
• Other Databases: GeneCards:  CDK5RAP3  Malacards:  CDK5RAP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005813	centrosome	IDA	cellular component
GO:1901798	positive regulation of signal transduction by p53 class mediator	IDA	biological process
GO:0005730	nucleolus	IDA	NOT|cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1900182	positive regulation of protein localization to nucleus	IDA	biological process
GO:1903363	negative regulation of cellular protein catabolic process	IDA	biological process
GO:2000060	positive regulation of ubiquitin-dependent protein catabolic process	IDA	NOT|biological process
GO:0031398	positive regulation of protein ubiquitination	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0008283	cell population proliferation	IDA	biological process
GO:0005874	microtubule	IDA	colocalizes with
GO:0001933	negative regulation of protein phosphorylation	IMP	biological process
GO:0071901	negative regulation of protein serine/threonine kinase activity	IMP	biological process
GO:0044818	mitotic G2/M transition checkpoint	IMP	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IMP	biological process
GO:0030262	apoptotic nuclear changes	IMP	biological process
GO:0010921	regulation of phosphatase activity	IMP	biological process
GO:0030968	endoplasmic reticulum unfolded protein response	IMP	biological process
GO:0044387	negative regulation of protein kinase activity by regulation of protein phosphorylation	IMP	biological process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular function
GO:0051059	NF-kappaB binding	IPI	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030332	cyclin binding	IPI	molecular function
GO:0097371	MDM2/MDM4 family protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IMP	biological process
GO:0043407	negative regulation of MAP kinase activity	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0071569	protein ufmylation	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0044389	ubiquitin-like protein ligase binding	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044389	ubiquitin-like protein ligase binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005815	microtubule organizing center	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045664	regulation of neuron differentiation	NAS	biological process
GO:0019901	protein kinase binding	NAS	molecular function
GO:0007420	brain development	NAS	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0000079	regulation of cyclin-dependent protein serine/threonine kinase activity	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray