• Gene id: 80273

Gene Summary

• Gene Symbol: GRPEL1   Gene   UCSC   Ensembl
• Aliases: GrpE, HMGE, mt-GrpE#1
• Gene name: GrpE like 1, mitochondrial
• Alternate names: grpE protein homolog 1, mitochondrial, GrpE-like protein cochaperone,
• Gene location: 4p16.1 (7068063: 7058894)     Exons: 4     NC_000004.12
• OMIM: 606173

Protein Summary

• Protein general information: Q9HAV7  
  • Name: GrpE protein homolog 1, mitochondrial (HMGE) (Mt GrpE#1)
  • Length: 217  
  • Mass: 24279
• Sequence:

  MAAQCVRLARRSLPALALSLRPSPRLLCTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETV
  EKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQ
  IQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

• Structural information:
  • Interpro: IPR000740  IPR013805  IPR009012  
  • Prosite: PS01071
  • CDD: cd00446
  • STRING: ENSP00000264954
• Other Databases: GeneCards:  GRPEL1  Malacards:  GRPEL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0051082	unfolded protein binding	IBA	molecular function
GO:0030150	protein import into mitochondrial matrix	IBA	biological process
GO:0001405	PAM complex, Tim23 associated import motor	IBA	cellular component
GO:0000774	adenyl-nucleotide exchange factor activity	IBA	molecular function
GO:0006457	protein folding	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0000774	adenyl-nucleotide exchange factor activity	IEA	molecular function
GO:0051087	chaperone binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005759	mitochondrial matrix	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0050790	regulation of catalytic activity	IEA	biological process
GO:0051082	unfolded protein binding	IDA	molecular function
GO:0005759	mitochondrial matrix	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881