• Gene id: 8027

Gene Summary

• Gene Symbol: STAM   Gene   UCSC   Ensembl
• Aliases: STAM-1, STAM1
• Gene name: signal transducing adaptor molecule
• Alternate names: signal transducing adapter molecule 1, HSE1 homolog, signal transducing adaptor molecule (SH3 domain and ITAM motif) 1,
• Gene location: 10p12.33 (17644149: 17716823)     Exons: 18     NC_000010.11
• Gene summary(Entrez): This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded pr
• OMIM: 601899

Protein Summary

• Protein general information: Q92783  
  • Name: Signal transducing adapter molecule 1 (STAM 1)
  • Length: 540  
  • Mass: 59180
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSN
  CGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGVTFPAIGSQAA
  EQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQHEGRKVRAIYDFEAAE
  DNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKKTVQFSDDVQVETIEPEPEPA
  FIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDIDRKHSELSELNVKVMEALSLYTKLM
  NEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSANPA
  LPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAAATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQ
  QPPQPQQPYSQKALL

• Structural information:
  • Protein Domains: (16..14-)
    (/note="VHS-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00218-)
    (171..19-)
    (/note="UIM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00213-)
    (210..26-)
    (/note="SH3-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00192-)
    (370-)
  • Interpro: IPR008942  IPR036028  IPR001452  IPR035657  IPR003903   IPR002014  
  • Prosite: PS50002 PS50330 PS50179
  • CDD: cd11964
  • PDB: 2L0A 3F1I 3LDZ
  • PDBsum: 2L0A 3F1I 3LDZ
  • DIP: 37761
  • STRING: ENSP00000366746
• Other Databases: GeneCards:  STAM  Malacards:  STAM

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033565	ESCRT-0 complex	TAS	cellular component
GO:0036258	multivesicular body assembly	TAS	biological process
GO:0016236	macroautophagy	TAS	biological process
GO:0033565	ESCRT-0 complex	IBA	cellular component
GO:0043328	protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IBA	biological process
GO:0006886	intracellular protein transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0007165	signal transduction	TAS	biological process
GO:0016197	endosomal transport	TAS	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031901	early endosome membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0033565	ESCRT-0 complex	IDA	cellular component
GO:1903551	regulation of extracellular exosome assembly	IMP	biological process
GO:1903543	positive regulation of exosomal secretion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0044389	ubiquitin-like protein ligase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04630	JAK-STAT signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881