• Gene id: 80232

Gene Summary

• Gene Symbol: WDR26   Gene   UCSC   Ensembl
• Aliases: CDW2, GID7, MIP2, SKDEAS
• Gene name: WD repeat domain 26
• Alternate names: WD repeat-containing protein 26, CUL4- and DDB1-associated WDR protein 2, GID complex subunit 7 homolog, myocardial ischemic preconditioning upregulated protein 2,
• Gene location: 1q42.11-q42.12 (224434796: 224385142)     Exons: 17     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein com
• OMIM: 617424

Protein Summary

• Protein general information: Q9H7D7  
  • Name: WD repeat containing protein 26 (CUL4 and DDB1 associated WDR protein 2) (Myocardial ischemic preconditioning up regulated protein 2)
  • Length: 661  
  • Mass: 72124
  • Tissue specificity: Broadly expressed, with highest levels in heart and skeletal muscle. {ECO
• Sequence:

  MQANGAGGGGGGGGGGGGGGGGGGGQGQTPELACLSAQNGESSPSSSSSAGDLAHANGLLPSAPSAASNNSNSLN
  VNNGVPGGAAAASSATVAAASATTAASSSLATPELGSSLKKKKRLSQSDEDVIRLIGQHLNGLGLNQTVDLLMQE
  SGCRLEHPSATKFRNHVMEGDWDKAENDLNELKPLVHSPHAIVVRGALEISQTLLGIIVRMKFLLLQQKYLEYLE
  DGKVLEALQVLRCELTPLKYNTERIHVLSGYLMCSHAEDLRAKAEWEGKGTASRSKLLDKLQTYLPPSVMLPPRR
  LQTLLRQAVELQRDRCLYHNTKLDNNLDSVSLLIDHVCSRRQFPCYTQQILTEHCNEVWFCKFSNDGTKLATGSK
  DTTVIIWQVDPDTHLLKLLKTLEGHAYGVSYIAWSPDDNYLVACGPDDCSELWLWNVQTGELRTKMSQSHEDSLT
  SVAWNPDGKRFVTGGQRGQFYQCDLDGNLLDSWEGVRVQCLWCLSDGKTVLASDTHQRIRGYNFEDLTDRNIVQE
  DHPIMSFTISKNGRLALLNVATQGVHLWDLQDRVLVRKYQGVTQGFYTIHSCFGGHNEDFIASGSEDHKVYIWHK
  RSELPIAELTGHTRTVNCVSWNPQIPSMMASASDDGTVRIWGPAPFIDHQNIEEECSSMDS

• Structural information:
  • Protein Domains: (123..15-)
    (/note="LisH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00126-)
    (156..23-)
    (/note="CTLH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00058"-)
  • Interpro: IPR006595  IPR006594  IPR015943  IPR001680  IPR017986   IPR036322  
  • Prosite: PS50897 PS50896 PS50082 PS50294
  • STRING: ENSP00000408108
• Other Databases: GeneCards:  WDR26  Malacards:  WDR26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000151	ubiquitin ligase complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

Diseases

Associated diseases	References
Skraban-Deardorff syndrome	KEGG:H02337
Skraban-Deardorff syndrome	KEGG:H02337
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)