• Gene id: 8019

Gene Summary

• Gene Symbol: BRD3   Gene   UCSC   Ensembl
• Aliases: ORFX, RING3L
• Gene name: bromodomain containing 3
• Alternate names: bromodomain-containing protein 3, RING3-like protein, bromodomain-containing protein 3 short isoform,
• Gene location: 9q34.2 (134068532: 134030304)     Exons: 15     NC_000009.12
• Gene summary(Entrez): This gene was identified based on its homology to the gene encoding the RING3 protein, a serine/threonine kinase. The gene localizes to 9q34, a region which contains several major histocompatibility complex (MHC) genes. The function of the encoded protein
• OMIM: 610465

Protein Summary

• Protein general information: Q15059  
  • Name: Bromodomain containing protein 3 (RING3 like protein)
  • Length: 726  
  • Mass: 79542
  • Tissue specificity: Ubiquitous.
• Sequence:

  MSTATTVAPAGIPATPGPVNPPPPEVSNPSKPGRKTNQLQYMQNVVVKTLWKHQFAWPFYQPVDAIKLNLPDYHK
  IIKNPMDMGTIKKRLENNYYWSASECMQDFNTMFTNCYIYNKPTDDIVLMAQALEKIFLQKVAQMPQEEVELLPP
  APKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSVPVPPAAAPPPPATP
  IVPVVPPTPPVVKKKGVKRKADTTTPTTSAITASRSESPPPLSDPKQAKVVARRESGGRPIKPPKKDLEDGEVPQ
  HAGKKGKLSEHLRYCDSILREMLSKKHAAYAWPFYKPVDAEALELHDYHDIIKHPMDLSTVKRKMDGREYPDAQG
  FAADVRLMFSNCYKYNPPDHEVVAMARKLQDVFEMRFAKMPDEPVEAPALPAPAAPMVSKGAESSRSSEESSSDS
  GSSDSEEERATRLAELQEQLKAVHEQLAALSQAPVNKPKKKKEKKEKEKKKKDKEKEKEKHKVKAEEEKKAKVAP
  PAKQAQQKKAPAKKANSTTTAGRQLKKGGKQASASYDSEEEEEGLPMSYDEKRQLSLDINRLPGEKLGRVVHIIQ
  SREPSLRDSNPDEIEIDFETLKPTTLRELERYVKSCLQKKQRKPFSASGKKQAAKSKEELAQEKKKELEKRLQDV
  SGQLSSSKKPARKEKPGSAPSGGPSRLSSSSSSESGSSSSSGSSSDSSDSE

• Structural information:
  • Protein Domains: (51..12-)
    (/note="Bromo-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035-)
    (326..39-)
    (/note="Bromo-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00035-)
    (562..64-)
    (/note="NET-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00857"-)
  • Interpro: IPR001487  IPR036427  IPR018359  IPR027353  IPR038336  
  • Prosite: PS00633 PS50014 PS51525
  • PDB: 2E7N 2NXB 2OO1 2YW5 3S91 3S92 5A7C 5HFR 5HJC 6BGG 6BGH 6I41 6I5P 6I68 6I7A
  • PDBsum: 2E7N 2NXB 2OO1 2YW5 3S91 3S92 5A7C 5HFR 5HJC 6BGG 6BGH 6I41 6I5P 6I68 6I7A
  • DIP: 39755
  • STRING: ENSP00000305918
• Other Databases: GeneCards:  BRD3  Malacards:  BRD3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0070577	lysine-acetylated histone binding	IDA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray