• Gene id: 80174

Gene Summary

• Gene Symbol: DBF4B   Gene   UCSC   Ensembl
• Aliases: ASKL1, CHIFB, DRF1, ZDBF1B
• Gene name: DBF4 zinc finger B
• Alternate names: protein DBF4 homolog B, ASK-like protein 1, DBF4 homolog B, Dbf4-related factor 1, activator of S-phase kinase-like protein 1, chiffon homolog B, zinc finger, DBF-type containing 1B,
• Gene location: 17q21 (44708580: 44752731)     Exons: 15     NC_000017.11
• Gene summary(Entrez): This gene encodes a regulator of the cell division cycle 7 homolog (S. cerevisiae) protein, a serine-threonine kinase which links cell cycle regulation to genome duplication. This protein localizes to the nucleus and, in complex with the cell division cyc
• OMIM: 602100

Protein Summary

• Protein general information: Q8NFT6  
  • Name: Protein DBF4 homolog B (Activator of S phase kinase like protein 1) (ASK like protein 1) (Chiffon homolog B) (Dbf4 related factor 1)
  • Length: 615  
  • Mass: 67243
  • Tissue specificity: Widely expressed. Highly expressed in testis. {ECO
• Sequence:

  MSEPGKGDDCLELESSMAESRLRAPDLGVSRCLGKCQKNSPGARKHPFSGKSFYLDLPAGKNLQFLTGAIQQLGG
  VIEGFLSKEVSYIVSSRREVKAESSGKSHRGCPSPSPSEVRVETSAMVDPKGSHPRPSRKPVDSVPLSRGKELLQ
  KAIRNQGSISGGGSGGSSSLLTNARSWGVRILHVDEMMMHVQQLSLASLCVKKQQPKKPEGTCPAAESRTRKVAR
  LKAPFLKIEDESRKFRPFHHQFKSFPEISFLGPKDASPFEAPTTLGSMHHTRESKDGEPSPRSAAHTMPRRKKGY
  CECCQEAFEELHVHLQSAQHRSFALEAHLYAEVDRIIAQLSHSFADIPFQAGLPRWSGSPASDCDPLCPETLHPH
  QPSHPRAASPRIRKEDSCQASVTQGRAAGQQRWTESLDGVMGPPASHTCVSATTLLPALPKGSREQGCLCPCPAS
  FTQSHLVTSLALLPGEWSPAEDMPLHPSQENSFAPADIPVKGPLLFPEARPWLMSARCWVRPFPFVTWGCLIPHD
  TTPLHEEVSPCPCLRLGYLYLLLTQSLWCRVRVPSLSTAGPIPRTSHPCTLAFPSYLNDHDLGHLCQAKPQGWNT
  PQPFLHCGFLAVDSG

• Structural information:
  • Protein Domains: (43..13-)
    (/note="BRCT"-)
  • Interpro: IPR006572  IPR038545  
  • Prosite: PS51265
  • STRING: ENSP00000323663
• Other Databases: GeneCards:  DBF4B  Malacards:  DBF4B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IBA	biological process
GO:1901987	regulation of cell cycle phase transition	IBA	biological process
GO:0031431	Dbf4-dependent protein kinase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	NOT|cellular component
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0043539	protein serine/threonine kinase activator activity	IBA	molecular function
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IBA	biological process
GO:1901987	regulation of cell cycle phase transition	IBA	biological process
GO:0031431	Dbf4-dependent protein kinase complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0008270	zinc ion binding	IEA	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0016235	aggresome	IDA	cellular component
GO:0071902	positive regulation of protein serine/threonine kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0032147	activation of protein kinase activity	IEA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0000790	nuclear chromatin	IDA	NOT|cellular component
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0030295	protein kinase activator activity	IDA	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010571	positive regulation of nuclear cell cycle DNA replication	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0010971	positive regulation of G2/M transition of mitotic cell cycle	IMP	biological process
GO:0008284	positive regulation of cell population proliferation	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq