• Gene id: 80168

Gene Summary

• Gene Symbol: MOGAT2   Gene   UCSC   Ensembl
• Aliases: DGAT2L5, DGAT2L5., MGAT2, hDC5
• Gene name: monoacylglycerol O-acyltransferase 2
• Alternate names: 2-acylglycerol O-acyltransferase 2, acyl-CoA:monoacylglycerol acyltransferase 2, diacylglycerol O-acyltransferase candidate 5, diacylglycerol acyltransferase 2-like protein 5,
• Gene location: 11q13.5 (75717818: 75732952)     Exons: 8     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is an enzyme that catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. The encoded protein is important in the uptake of dietary fat by the small intestine. This protein forms a complex wit
• OMIM: 609336

Protein Summary

• Protein general information: Q3SYC2  
  • Name: 2 acylglycerol O acyltransferase 2 (EC 2.3.1.22) (Acyl CoA:monoacylglycerol acyltransferase 2) (MGAT2) (hMGAT2) (Diacylglycerol O acyltransferase candidate 5) (hDC5) (Diacylglycerol acyltransferase 2 like protein 5) (Monoacylglycerol O acyltransferase 2)
  • Length: 334  
  • Mass: 38196
  • Tissue specificity: Highly expressed in liver, small intestine, colon, stomach and kidney. {ECO
• Sequence:

  MVEFAPLFMPWERRLQTLAVLQFVFSFLALAEICTVGFIALLFTRFWLLTVLYAAWWYLDRDKPRQGGRHIQAIR
  CWTIWKYMKDYFPISLVKTAELDPSRNYIAGFHPHGVLAVGAFANLCTESTGFSSIFPGIRPHLMMLTLWFRAPF
  FRDYIMSAGLVTSEKESAAHILNRKGGGNLLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFS
  FGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEE
  VNQLHQRYIKELCNLFEAHKLKFNIPADQHLEFC

• Structural information:
  • Interpro: IPR007130  
  • STRING: ENSP00000198801
• Other Databases: GeneCards:  MOGAT2  Malacards:  MOGAT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004144	diacylglycerol O-acyltransferase activity	IBA	molecular function
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0008374	O-acyltransferase activity	IBA	molecular function
GO:0003846	2-acylglycerol O-acyltransferase activity	IBA	molecular function
GO:0006629	lipid metabolic process	IBA	biological process
GO:0006651	diacylglycerol biosynthetic process	IBA	biological process
GO:0019432	triglyceride biosynthetic process	IBA	biological process
GO:0006640	monoacylglycerol biosynthetic process	IDA	biological process
GO:0003846	2-acylglycerol O-acyltransferase activity	IDA	molecular function
GO:1990578	perinuclear endoplasmic reticulum membrane	IDA	cellular component
GO:0016747	transferase activity, transferring acyl groups other than amino-acyl groups	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0006071	glycerol metabolic process	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003846	2-acylglycerol O-acyltransferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0019432	triglyceride biosynthetic process	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0016407	acetyltransferase activity	IEA	molecular function
GO:0050892	intestinal absorption	IEA	biological process
GO:0019432	triglyceride biosynthetic process	IEA	biological process
GO:0006651	diacylglycerol biosynthetic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0003846	2-acylglycerol O-acyltransferase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0019432	triglyceride biosynthetic process	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa00561	Glycerolipid metabolism
hsa04975	Fat digestion and absorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq