• Gene id: 80155

Gene Summary

• Gene Symbol: NAA15   Gene   UCSC   Ensembl
• Aliases: Ga19, MRD50, NARG1, NAT1P, NATH, TBDN, TBDN100
• Gene name: N-alpha-acetyltransferase 15, NatA auxiliary subunit
• Alternate names: N-alpha-acetyltransferase 15, NatA auxiliary subunit, N-terminal acetyltransferase, NMDA receptor regulated 1, NMDA receptor-regulated protein 1, gastric cancer antigen Ga19, protein tubedown-1, transcriptional coactivator tubedown-100, tubedown-1,
• Gene location: 4q31.1 (139301498: 139391383)     Exons: 20     NC_000004.12
• Gene summary(Entrez): N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for
• OMIM: 608000

Protein Summary

• Protein general information: Q9BXJ9  
  • Name: N alpha acetyltransferase 15, NatA auxiliary subunit (Gastric cancer antigen Ga19) (N terminal acetyltransferase) (NMDA receptor regulated protein 1) (Protein tubedown 1) (Tbdn100)
  • Length: 866  
  • Mass: 101272
  • Tissue specificity: Expressed at high levels in testis and in ocular endothelial cells. Also found in brain (corpus callosum), heart, colon, bone marrow and at lower levels in most adult tissues, including thyroid, liver, pancreas, mammary and salivary gl
• Sequence:

  MPAVSLPPKENALFKRILRCYEHKQYRNGLKFCKQILSNPKFAEHGETLAMKGLTLNCLGKKEEAYELVRRGLRN
  DLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDLSLLQIQMRDLEGYRETRYQLLQLRPAQRAS
  WIGYAIAYHLLEDYEMAAKILEEFRKTQQTSPDKVDYEYSELLLYQNQVLREAGLYREALEHLCTYEKQICDKLA
  VEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKALKPANMLERLKIYEEAWTKYPRGLVPRRLPLNF
  LSGEKFKECLDKFLRMNFSKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSCRLFNPNDDGKEEPPTTLLW
  VQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKHAGNIKEAARWMDEAQALDTADRFINSKCAK
  YMLKANLIKEAEEMCSKFTREGTSAVENLNEMQCMWFQTECAQAYKAMNKFGEALKKCHEIERHFIEITDDQFDF
  HTYCMRKITLRSYVDLLKLEDVLRQHPFYFKAARIAIEIYLKLHDNPLTDENKEHEADTANMSDKELKKLRNKQR
  RAQKKAQIEEEKKNAEKEKQQRNQKKKKDDDDEEIGGPKEELIPEKLAKVETPLEEAIKFLTPLKNLVKNKIETH
  LFAFEIYFRKEKFLLMLQSVKRAFAIDSSHPWLHECMIRLFNTAVCESKDLSDTVRTVLKQEMNRLFGATNPKNF
  NETFLKRNSDSLPHRLSAAKMVYYLDPSSQKRAIELATTLDESLTNRNLQTCMEVLEALYDGSLGDCKEAAEIYR
  ANCHKLFPYALAFMPPGYEEDMKITVNGDSSAEAEELANEI

• Structural information:
  • Interpro: IPR021183  IPR013026  IPR011990  IPR019734  
  • Prosite: PS50005 PS50293
  • PDB: 6C95 6C9M
  • PDBsum: 6C95 6C9M
  • STRING: ENSP00000296543
• Other Databases: GeneCards:  NAA15  Malacards:  NAA15

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0004596	peptide alpha-N-acetyltransferase activity	IBA	contributes to
GO:0031415	NatA complex	IBA	cellular component
GO:0017196	N-terminal peptidyl-methionine acetylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031415	NatA complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0001525	angiogenesis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0043022	ribosome binding	IDA	contributes to
GO:0005667	transcription regulator complex	IDA	cellular component
GO:0043022	ribosome binding	IDA	molecular function
GO:0016407	acetyltransferase activity	IDA	contributes to
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043066	negative regulation of apoptotic process	IMP	biological process
GO:0050821	protein stabilization	IMP	biological process

Diseases

Associated diseases	References
Autosomal dominant mental retardation	KEGG:H00773
Autosomal dominant mental retardation	KEGG:H00773
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq