• Gene id: 80152

Gene Summary

• Gene Symbol: CENPT   Gene   UCSC   Ensembl
• Aliases: C16orf56, CENP-T, SSMGA
• Gene name: centromere protein T
• Alternate names: centromere protein T, interphase centromere complex protein 22,
• Gene location: 16q22.1 (97572440: 97583883)     Exons: 9     NC_000010.11
• Gene summary(Entrez): The centromere is a specialized chromatin domain, present throughout the cell cycle, that acts as a platform on which the transient assembly of the kinetochore occurs during mitosis. All active centromeres are characterized by the presence of long arrays
• OMIM: 611510

Protein Summary

• Protein general information: Q96BT3  
  • Name: Centromere protein T (CENP T) (Interphase centromere complex protein 22)
  • Length: 561  
  • Mass: 60423
• Sequence:

  MADHNPDSDSTPRTLLRRVLDTADPRTPRRPRSARAGARRALLETASPRKLSGQTRTIARGRSHGARSVGRSAHI
  QASGHLEEQTPRTLLKNILLTAPESSILMPESVVKPVPAPQAVQPSRQESSCGSLELQLPELEPPTTLAPGLLAP
  GRRKQRLRLSVFQQGVDQGLSLSQEPQGNADASSLTRSLNLTFATPLQPQSVQRPGLARRPPARRAVDVGAFLRD
  LRDTSLAPPNIVLEDTQPFSQPMVGSPNVYHSLPCTPHTGAEDAEQAAGRKTQSSGPGLQKNSPGKPAQFLAGEA
  EEVNAFALGFLSTSSGVSGEDEVEPLHDGVEEAEKKMEEEGVSVSEMEATGAQGPSRVEEAEGHTEVTEAEGSQG
  TAEADGPGASSGDEDASGRAASPESASSTPESLQARRHHQFLEPAPAPGAAVLSSEPAEPLLVRHPPRPRTTGPR
  PRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCLDKYFQHLCDDLEVFAAHAGRKTVKPEDLELLMRRQGLV
  TDQVSLHVLVERHLPLEYRQLLIPCAYSGNSVFPAQ

• Structural information:
  • Interpro: IPR028255  IPR035425  IPR032373  IPR009072  
  • STRING: ENSP00000457810
• Other Databases: GeneCards:  CENPT  Malacards:  CENPT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000278	mitotic cell cycle	IBA	biological process
GO:0000778	condensed nuclear chromosome kinetochore	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:1903394	protein localization to kinetochore involved in kinetochore assembly	IBA	biological process
GO:0000776	kinetochore	IDA	cellular component
GO:0000775	chromosome, centromeric region	IDA	cellular component
GO:0000278	mitotic cell cycle	IMP	biological process
GO:0051382	kinetochore assembly	IMP	biological process
GO:0051276	chromosome organization	IMP	biological process
GO:0007059	chromosome segregation	IMP	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0051382	kinetochore assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0000776	kinetochore	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0034080	CENP-A containing nucleosome assembly	TAS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0000777	condensed chromosome kinetochore	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq