• Gene id: 80150

Gene Summary

• Gene Symbol: ASRGL1   Gene   UCSC   Ensembl
• Aliases: ALP, ALP1, CRASH
• Gene name: asparaginase like 1
• Alternate names: isoaspartyl peptidase/L-asparaginase, L-asparaginase, L-asparagine amidohydrolase, asparaginase-like 1 protein, asparaginase-like protein 1, beta-aspartyl-peptidase, isoaspartyl dipeptidase, testis secretory sperm-binding protein Li 242mP,
• Gene location: 11q12.3 (62337301: 62401400)     Exons: 10     NC_000011.10
• OMIM: 609212

Protein Summary

• Protein general information: Q7L266  
  • Name: Isoaspartyl peptidase/L asparaginase (EC 3.4.19.5) (EC 3.5.1.1) (Asparaginase like protein 1) (Beta aspartyl peptidase) (Isoaspartyl dipeptidase) (L asparagine amidohydrolase) [Cleaved into: Isoaspartyl peptidase/L asparaginase alpha chain; Isoaspartyl pe
  • Length: 308  
  • Mass: 32,055
• Sequence:

  MNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEV
  EMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEK
  EKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESI
  LKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPD
  DTTITDLP

• Structural information:
  • Interpro: IPR033844  IPR029055  IPR000246  
  • CDD: cd04702
  • PDB: 3TKJ 4ET0 4O0C 4O0D 4O0E 4O0F 4O0G 4O0H 4OSX 4OSY 4PVP 4PVQ 4PVR 4PVS 4ZM9
  • PDBsum: 3TKJ 4ET0 4O0C 4O0D 4O0E 4O0F 4O0G 4O0H 4OSX 4OSY 4PVP 4PVQ 4PVR 4PVS 4ZM9
  • STRING: ENSP00000301776
• Other Databases: GeneCards:  ASRGL1  Malacards:  ASRGL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004067	asparaginase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006559	L-phenylalanine catabolic process	TAS	biological process
GO:0008798	beta-aspartyl-peptidase activity	IDA	molecular function
GO:0008798	beta-aspartyl-peptidase activity	TAS	molecular function
GO:0033345	asparagine catabolic process via L-aspartate	ISS	biological process
GO:0033345	asparagine catabolic process via L-aspartate	IDA	biological process
GO:0003948	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	IDA	molecular function
GO:0004067	asparaginase activity	IEA	molecular function
GO:0004067	asparaginase activity	IEA	molecular function
GO:0004067	asparaginase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006508	proteolysis	IEA	biological process
GO:0006559	L-phenylalanine catabolic process	TAS	biological process
GO:0008233	peptidase activity	IEA	molecular function
GO:0008798	beta-aspartyl-peptidase activity	IEA	molecular function
GO:0008798	beta-aspartyl-peptidase activity	IDA	molecular function
GO:0008798	beta-aspartyl-peptidase activity	TAS	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0033345	asparagine catabolic process via L-aspartate	IEA	biological process
GO:0033345	asparagine catabolic process via L-aspartate	ISS	biological process
GO:0033345	asparagine catabolic process via L-aspartate	IDA	biological process
GO:0003948	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	IDA	molecular function
GO:0004067	asparaginase activity	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	ISS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006559	L-phenylalanine catabolic process	TAS	biological process
GO:0008798	beta-aspartyl-peptidase activity	IDA	molecular function
GO:0008798	beta-aspartyl-peptidase activity	TAS	molecular function
GO:0033345	asparagine catabolic process via L-aspartate	ISS	biological process
GO:0033345	asparagine catabolic process via L-aspartate	IDA	biological process
GO:0003948	N4-(beta-N-acetylglucosaminyl)-L-asparaginase activity	IDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways

Diseases

Associated diseases	References
Male factor infertility	MIK: 25825237
Asthenozoospermia	MIK: 25825237
Asthenozoospermia	MIK: 25825237
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25825237	Asthenozoospermia				Male infertility	Tubulin beta 2B; glutathione S-transferase Mu 3; keratin type II cytoskeletal 1; outer dense fiber protein 2; voltage-dependent anion-selective channel protein 2; A-kinase anchor protein 4; cytochrome c oxidase subunit 6B; sperm protein associated with t
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray