• Gene id: 80149

Gene Summary

• Gene Symbol: ZC3H12A   Gene   UCSC   Ensembl
• Aliases: MCPIP, MCPIP-1, MCPIP1, Reg1, dJ423B22.1
• Gene name: zinc finger CCCH-type containing 12A
• Alternate names: endoribonuclease ZC3H12A, MCP-1 treatment-induced protein, MCP-induced protein 1, bifunctional endoribonuclease and deubiquitinase ZC3H12A, monocyte chemotactic protein-induced protein 1, regnase-1, ribonuclease ZC3H12A, zinc finger CCCH domain-containing protei,
• Gene location: 1p34.3 (37474517: 37484376)     Exons: 6     NC_000001.11
• Gene summary(Entrez): ZC3H12A is an MCP1 (CCL2; MIM 158105)-induced protein that acts as a transcriptional activator and causes cell death of cardiomyocytes, possibly via induction of genes associated with apoptosis.[supplied by OMIM, Mar 2008]
• OMIM: 610562

Protein Summary

• Protein general information: Q5D1E8  
  • Name: Endoribonuclease ZC3H12A (EC 3.1. . ) (Monocyte chemotactic protein induced protein 1) (MCP induced protein 1) (MCPIP 1) (Regnase 1) (Reg1) (Zinc finger CCCH domain containing protein 12A)
  • Length: 599  
  • Mass: 65699
  • Tissue specificity: Expressed in heart, placenta, spleen, kidney, liver and lung (PubMed
• Sequence:

  MSGPCGEKPVLEASPTMSLWEFEDSHSRQGTPRPGQELAAEEASALELQMKVDFFRKLGYSSTEIHSVLQKLGVQ
  ADTNTVLGELVKHGTATERERQTSPDPCPQLPLVPRGGGTPKAPNLEPPLPEEEKEGSDLRPVVIDGSNVAMSHG
  NKEVFSCRGILLAVNWFLERGHTDITVFVPSWRKEQPRPDVPITDQHILRELEKKKILVFTPSRRVGGKRVVCYD
  DRFIVKLAYESDGIVVSNDTYRDLQGERQEWKRFIEERLLMYSFVNDKFMPPDDPLGRHGPSLDNFLRKKPLTLE
  HRKQPCPYGRKCTYGIKCRFFHPERPSCPQRSVADELRANALLSPPRAPSKDKNGRRPSPSSQSSSLLTESEQCS
  LDGKKLGAQASPGSRQEGLTQTYAPSGRSLAPSGGSGSSFGPTDWLPQTLDSLPYVSQDCLDSGIGSLESQMSEL
  WGVRGGGPGEPGPPRAPYTGYSPYGSELPATAAFSAFGRAMGAGHFSVPADYPPAPPAFPPREYWSEPYPLPPPT
  SVLQEPPVQSPGAGRSPWGRAGSLAKEQASVYTKLCGVFPPHLVEAVMGRFPQLLDPQQLAAEILSYKSQHPSE

• Structural information:
  • Interpro: IPR040546  IPR040757  IPR021869  
  • PDB: 3V32 3V33 3V34
  • PDBsum: 3V32 3V33 3V34
  • STRING: ENSP00000362179
• Other Databases: GeneCards:  ZC3H12A  Malacards:  ZC3H12A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0036464	cytoplasmic ribonucleoprotein granule	IBA	cellular component
GO:0004521	endoribonuclease activity	IBA	molecular function
GO:0003729	mRNA binding	IBA	molecular function
GO:0000294	nuclear-transcribed mRNA catabolic process, endonucleolytic cleavage-dependent decay	IBA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IBA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0051259	protein complex oligomerization	IDA	biological process
GO:0051259	protein complex oligomerization	IDA	biological process
GO:0035198	miRNA binding	IDA	molecular function
GO:0000932	P-body	IDA	cellular component
GO:1903799	negative regulation of production of miRNAs involved in gene silencing by miRNA	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0000932	P-body	IDA	cellular component
GO:0071356	cellular response to tumor necrosis factor	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0004540	ribonuclease activity	IDA	molecular function
GO:0003723	RNA binding	IDA	molecular function
GO:0098586	cellular response to virus	IDA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IDA	biological process
GO:2000627	positive regulation of miRNA catabolic process	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010942	positive regulation of cell death	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:1990869	cellular response to chemokine	IDA	biological process
GO:0002757	immune response-activating signal transduction	IDA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005856	cytoskeleton	IDA	cellular component
GO:0061014	positive regulation of mRNA catabolic process	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:1900745	positive regulation of p38MAPK cascade	IDA	biological process
GO:0042307	positive regulation of protein import into nucleus	IDA	biological process
GO:0003682	chromatin binding	IDA	molecular function
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0016579	protein deubiquitination	IDA	biological process
GO:2000627	positive regulation of miRNA catabolic process	IDA	biological process
GO:0010468	regulation of gene expression	IDA	biological process
GO:0044828	negative regulation by host of viral genome replication	IDA	biological process
GO:0002230	positive regulation of defense response to virus by host	IDA	biological process
GO:0003677	DNA binding	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045766	positive regulation of angiogenesis	IDA	biological process
GO:1990869	cellular response to chemokine	IDA	biological process
GO:0055118	negative regulation of cardiac muscle contraction	ISS	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0005791	rough endoplasmic reticulum	ISS	cellular component
GO:0035613	RNA stem-loop binding	ISS	molecular function
GO:0004521	endoribonuclease activity	ISS	molecular function
GO:1904637	cellular response to ionomycin	ISS	biological process
GO:0035925	mRNA 3'-UTR AU-rich region binding	ISS	molecular function
GO:0004532	exoribonuclease activity	ISS	molecular function
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IMP	biological process
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IMP	contributes to
GO:1900119	positive regulation of execution phase of apoptosis	ISS	biological process
GO:0042149	cellular response to glucose starvation	ISS	biological process
GO:0034599	cellular response to oxidative stress	ISS	biological process
GO:0001933	negative regulation of protein phosphorylation	ISS	biological process
GO:0000294	nuclear-transcribed mRNA catabolic process, endonucleolytic cleavage-dependent decay	ISS	biological process
GO:0043022	ribosome binding	ISS	molecular function
GO:1902714	negative regulation of interferon-gamma secretion	ISS	biological process
GO:1900165	negative regulation of interleukin-6 secretion	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1900016	negative regulation of cytokine production involved in inflammatory response	ISS	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	ISS	biological process
GO:0010656	negative regulation of muscle cell apoptotic process	ISS	biological process
GO:0042406	extrinsic component of endoplasmic reticulum membrane	ISS	cellular component
GO:0003730	mRNA 3'-UTR binding	ISS	molecular function
GO:0090501	RNA phosphodiester bond hydrolysis	ISS	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	ISS	biological process
GO:0061014	positive regulation of mRNA catabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1903003	positive regulation of protein deubiquitination	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903936	cellular response to sodium arsenite	ISS	biological process
GO:0071347	cellular response to interleukin-1	ISS	biological process
GO:0045766	positive regulation of angiogenesis	IMP	biological process
GO:2000320	negative regulation of T-helper 17 cell differentiation	ISS	biological process
GO:0050852	T cell receptor signaling pathway	ISS	biological process
GO:1904468	negative regulation of tumor necrosis factor secretion	ISS	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	ISS	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0004519	endonuclease activity	IEA	molecular function
GO:0001525	angiogenesis	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0007275	multicellular organism development	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000294	nuclear-transcribed mRNA catabolic process, endonucleolytic cleavage-dependent decay	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0004518	nuclease activity	IEA	molecular function
GO:0004521	endoribonuclease activity	IEA	molecular function
GO:0004532	exoribonuclease activity	IEA	molecular function
GO:0005791	rough endoplasmic reticulum	IEA	cellular component
GO:0034599	cellular response to oxidative stress	IEA	biological process
GO:0035613	RNA stem-loop binding	IEA	molecular function
GO:0035925	mRNA 3'-UTR AU-rich region binding	IEA	molecular function
GO:0042149	cellular response to glucose starvation	IEA	biological process
GO:0043022	ribosome binding	IEA	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045600	positive regulation of fat cell differentiation	IEA	biological process
GO:0055118	negative regulation of cardiac muscle contraction	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:1900119	positive regulation of execution phase of apoptosis	IEA	biological process
GO:1900165	negative regulation of interleukin-6 secretion	IEA	biological process
GO:1902714	negative regulation of interferon-gamma secretion	IEA	biological process
GO:1904637	cellular response to ionomycin	IEA	biological process
GO:0003730	mRNA 3'-UTR binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0010508	positive regulation of autophagy	IEA	biological process
GO:0010629	negative regulation of gene expression	IEA	biological process
GO:0010656	negative regulation of muscle cell apoptotic process	IEA	biological process
GO:0010884	positive regulation of lipid storage	IEA	biological process
GO:0042406	extrinsic component of endoplasmic reticulum membrane	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0050713	negative regulation of interleukin-1 beta secretion	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0061014	positive regulation of mRNA catabolic process	IEA	biological process
GO:0061158	3'-UTR-mediated mRNA destabilization	IEA	biological process
GO:0071347	cellular response to interleukin-1	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:1900016	negative regulation of cytokine production involved in inflammatory response	IEA	biological process
GO:1901223	negative regulation of NIK/NF-kappaB signaling	IEA	biological process
GO:1903936	cellular response to sodium arsenite	IEA	biological process
GO:1904468	negative regulation of tumor necrosis factor secretion	IEA	biological process
GO:1990869	cellular response to chemokine	IEA	biological process
GO:2000320	negative regulation of T-helper 17 cell differentiation	IEA	biological process
GO:0010628	positive regulation of gene expression	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0045019	negative regulation of nitric oxide biosynthetic process	IDA	biological process
GO:0045600	positive regulation of fat cell differentiation	IDA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0010508	positive regulation of autophagy	IDA	biological process
GO:0010629	negative regulation of gene expression	IDA	biological process
GO:0010884	positive regulation of lipid storage	IDA	biological process
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0032715	negative regulation of interleukin-6 production	IDA	biological process
GO:0043031	negative regulation of macrophage activation	IC	biological process
GO:2000379	positive regulation of reactive oxygen species metabolic process	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0030867	rough endoplasmic reticulum membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000932	P-body	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881