• Gene id: 80145

Gene Summary

• Gene Symbol: THOC7   Gene   UCSC   Ensembl
• Aliases: NIF3L1BP1, fSAP24, hTREX30
• Gene name: THO complex 7
• Alternate names: THO complex subunit 7 homolog, NIF3L1-binding protein 1, Ngg1 interacting factor 3 like 1 binding protein 1, THO complex 7 homolog, functional spliceosome-associated protein 24, ngg1-interacting factor 3-like protein 1-binding protein 1,
• Gene location: 3p14.1 (63864477: 63833869)     Exons: 9     NC_000003.12
• OMIM: 611965

Protein Summary

• Protein general information: Q6I9Y2  
  • Name: THO complex subunit 7 homolog (Functional spliceosome associated protein 24) (fSAP24) (Ngg1 interacting factor 3 like protein 1 binding protein 1) (NIF3L1 binding protein 1) (hTREX30)
  • Length: 204  
  • Mass: 23743
• Sequence:

  MGAVTDDEVIRKRLLIDGDGAGDDRRINLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNL
  REMENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQHHPDRHETLKELEALGKELEHLS
  HIKESVEDKLELRRKQFHVLLSTIHELQQTLENDEKLSEVEEAQEASMETDPKP

• Structural information:
  • Interpro: IPR008501  
  • STRING: ENSP00000295899
• Other Databases: GeneCards:  THOC7  Malacards:  THOC7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006406	mRNA export from nucleus	IBA	biological process
GO:0000445	THO complex part of transcription export complex	IBA	cellular component
GO:0046784	viral mRNA export from host cell nucleus	IDA	biological process
GO:0000445	THO complex part of transcription export complex	IDA	cellular component
GO:0000347	THO complex	IDA	cellular component
GO:0006406	mRNA export from nucleus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000346	transcription export complex	IDA	cellular component
GO:0000346	transcription export complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000445	THO complex part of transcription export complex	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0051028	mRNA transport	IEA	biological process
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0008380	RNA splicing	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006406	mRNA export from nucleus	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006405	RNA export from nucleus	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000784	nuclear chromosome, telomeric region	IDA	colocalizes with
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)