• Gene id: 80143

Gene Summary

• Gene Symbol: SIKE1   Gene   UCSC   Ensembl
• Aliases: SIKE
• Gene name: suppressor of IKBKE 1
• Alternate names: suppressor of IKBKE 1, suppressor of IKK epsilon,
• Gene location: 1p13.2 (114780684: 114769478)     Exons: 4     NC_000001.11
• Gene summary(Entrez): SIKE interacts with IKK-epsilon (IKBKE; MIM 605048) and TBK1 (MIM 604834) and acts as a suppressor of TLR3 (MIM 603029) and virus-triggered interferon activation pathways (Huang et al., 2005 [PubMed 16281057]).[supplied by OMIM, Mar 2008]
• OMIM: 611656

Protein Summary

• Protein general information: Q9BRV8  
  • Name: Suppressor of IKBKE 1 (Suppressor of IKK epsilon)
  • Length: 207  
  • Mass: 23721
  • Tissue specificity: Widely expressed. Expressed in brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung and leukocytes. Present in all cell lines tested (at protein level). {ECO
• Sequence:

  MSCTIEKILTDAKTLLERLREHDAAAESLVDQSAALHRRVAAMREAGTALPDQYQEDASDMKDMSKYKPHILLSQ
  ENTQIRDLQQENRELWISLEEHQDALELIMSKYRKQMLQLMVAKKAVDAEPVLKAHQSHSAEIESQIDRICEMGE
  VMRKAVQVDDDQFCKIQEKLAQLELENKELRELLSISSESLQARKENSMDTASQAIK

• Structural information:
  • Interpro: IPR008555  
  • PDB: 6AKK 6AKL 6AKM
  • PDBsum: 6AKK 6AKL 6AKM
  • STRING: ENSP00000358541
• Other Databases: GeneCards:  SIKE1  Malacards:  SIKE1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005737	cytoplasm	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0019901	protein kinase binding	IPI	molecular function
GO:0017048	Rho GTPase binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04622	RIG-I-like receptor signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray