• Gene id: 80142

Gene Summary

• Gene Symbol: PTGES2   Gene   UCSC   Ensembl
• Aliases: C9orf15, GBF-1, GBF1, PGES2, mPGES-2
• Gene name: prostaglandin E synthase 2
• Alternate names: prostaglandin E synthase 2, GATE-binding factor 1, gamma-interferon-activated transcriptional element-binding factor 1, mPGE synthase-2, membrane-associated prostaglandin E synthase 2, microsomal prostaglandin E synthase-2, prostaglandin-H(2) E-isomerase,
• Gene location: 9q34.11 (128128461: 128120692)     Exons: 10     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a membrane-associated prostaglandin E synthase, which catalyzes the conversion of prostaglandin H2 to prostaglandin E2. This protein also has been shown to activate the transcription regulated by a gamma-interferon-acti
• OMIM: 608152

Protein Summary

• Protein general information: Q9H7Z7  
  • Name: Prostaglandin E synthase 2 (Membrane associated prostaglandin E synthase 2) (mPGE synthase 2) (Microsomal prostaglandin E synthase 2) (mPGES 2) (Prostaglandin H(2) E isomerase) (EC 5.3.99.3) [Cleaved into: Prostaglandin E synthase 2 truncated form]
  • Length: 377  
  • Mass: 41943
  • Tissue specificity: Widely expressed. Expressed in the heart, including apex, inter-ventricular septum, both atria and ventricles, but not in the aorta. Also expressed in fetal heart. Detected in various regions of the brain
• Sequence:

  MDPAARVVRALWPGGCALAWRLGGRPQPLLPTQSRAGFAGAAGGPSPVAAARKGSPRLLGAAALALGGALGLYHT
  ARWHLRAQDLHAERSAAQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVRRAEIKFSSYRKVPI
  LVAQEGESSQQLNDSSVIISALKTYLVSGQPLEEIITYYPAMKAVNEQGKEVTEFGNKYWLMLNEKEAQQVYGGK
  EARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGAVEGAVAKYMGAAAMYLISKRLKSRHRLQ
  DNVREDLYEAADKWVAAVGKDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERAITEASP
  AH

• Structural information:
  • Protein Domains: (90..19-)
    (/note="Glutaredoxin-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00686-)
    (263..37-)
    (/note="GST-C-terminal")
  • Interpro: IPR002109  IPR010987  IPR036282  IPR040079  IPR004045   IPR034334  IPR034335  IPR036249  
  • Prosite: PS00195 PS51354 PS50405
  • CDD: cd03197
  • STRING: ENSP00000345341
• Other Databases: GeneCards:  PTGES2  Malacards:  PTGES2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0050220	prostaglandin-E synthase activity	IBA	molecular function
GO:0043295	glutathione binding	ISS	molecular function
GO:0020037	heme binding	ISS	molecular function
GO:0016829	lyase activity	ISS	molecular function
GO:0015035	protein disulfide oxidoreductase activity	IEA	molecular function
GO:0050220	prostaglandin-E synthase activity	IEA	molecular function
GO:0009055	electron transfer activity	IEA	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0006633	fatty acid biosynthetic process	IEA	biological process
GO:0016853	isomerase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0050220	prostaglandin-E synthase activity	IEA	molecular function
GO:0050220	prostaglandin-E synthase activity	IDA	molecular function
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019371	cyclooxygenase pathway	TAS	biological process
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0046903	secretion	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0022900	electron transport chain	IEA	biological process
GO:0001516	prostaglandin biosynthetic process	IEA	biological process
GO:0005739	mitochondrion	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00590	Arachidonic acid metabolism

Diseases

Associated diseases	References
Penile cancer	KEGG:H00025
Penile cancer	KEGG:H00025
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq