• Gene id: 8013

Gene Summary

• Gene Symbol: NR4A3   Gene   UCSC   Ensembl
• Aliases: CHN, CSMF, MINOR, NOR1, TEC
• Gene name: nuclear receptor subfamily 4 group A member 3
• Alternate names: nuclear receptor subfamily 4 group A member 3, chondrosarcoma, extraskeletal myxoid, fused to EWS, mitogen-induced nuclear orphan receptor, neuron-derived orphan receptor 1, nuclear hormone receptor NOR-1, translocated in extraskeletal chondrosarcoma,
• Gene location: 9q31.1 (99821854: 99866892)     Exons: 10     NC_000009.12
• Gene summary(Entrez): This gene encodes a member of the steroid-thyroid hormone-retinoid receptor superfamily. The encoded protein may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskel
• OMIM: 607901

Protein Summary

• Protein general information: Q92570  
  • Name: Nuclear receptor subfamily 4 group A member 3 (Mitogen induced nuclear orphan receptor) (Neuron derived orphan receptor 1) (Nuclear hormone receptor NOR 1)
  • Length: 626  
  • Mass: 68230
  • Tissue specificity: Isoform alpha is highly expressed in skeletal muscle. Isoform beta is highly expressed in skeletal muscle and low expressed in fetal brain and placenta.
• Sequence:

  MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSISTFVEGYSSNYELKPSC
  VYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLPSTSMYFKQSPPSTPTTPAFPP
  QAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHHLGYDPTAAAALSLPL
  GAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSPPSRSSSSGEGTCAVCGDNAA
  CQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQKCLSVGMVKEVVRTDSLKGRRGRLP
  SKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYCPTDQAAAGTDAEHVQQFYNLLTASIDVSRS
  WAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAEDKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQ
  SLNLDIQALACLSALSMITERHGLKEPKRVEELCNKITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQR
  IFYLKLEDLVSPPSIIDKLFLDTLPF

• Structural information:
  • Protein Domains: (394..62-)
    (/note="NR-LBD)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01189"-)
  • Interpro: IPR035500  IPR003072  IPR003070  IPR000536  IPR001723   IPR001628  IPR013088  
  • Prosite: PS51843 PS00031 PS51030
  • STRING: ENSP00000482027
• Other Databases: GeneCards:  NR4A3  Malacards:  NR4A3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0043565	sequence-specific DNA binding	IBA	molecular function
GO:0000977	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005667	transcription regulator complex	IBA	cellular component
GO:0035259	glucocorticoid receptor binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	IBA	biological process
GO:0048660	regulation of smooth muscle cell proliferation	IDA	biological process
GO:0010828	positive regulation of glucose transmembrane transport	IDA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010613	positive regulation of cardiac muscle hypertrophy	ISS	biological process
GO:0061469	regulation of type B pancreatic cell proliferation	ISS	biological process
GO:0043303	mast cell degranulation	ISS	biological process
GO:0035497	cAMP response element binding	ISS	molecular function
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	ISS	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0071870	cellular response to catecholamine stimulus	ISS	biological process
GO:0046321	positive regulation of fatty acid oxidation	ISS	biological process
GO:0045333	cellular respiration	ISS	biological process
GO:0050679	positive regulation of epithelial cell proliferation	ISS	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:1900625	positive regulation of monocyte aggregation	IMP	biological process
GO:0035726	common myeloid progenitor cell proliferation	ISS	biological process
GO:0038097	positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway	ISS	biological process
GO:0032765	positive regulation of mast cell cytokine production	ISS	biological process
GO:0097009	energy homeostasis	ISS	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	ISS	biological process
GO:2000253	positive regulation of feeding behavior	ISS	biological process
GO:0044320	cellular response to leptin stimulus	ISS	biological process
GO:0009444	pyruvate oxidation	ISS	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	ISS	biological process
GO:0007369	gastrulation	ISS	biological process
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	ISS	biological process
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0003707	steroid hormone receptor activity	IEA	molecular function
GO:0004879	nuclear receptor activity	IEA	molecular function
GO:0008270	zinc ion binding	IEA	molecular function
GO:0042025	host cell nucleus	IEA	cellular component
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003707	steroid hormone receptor activity	TAS	molecular function
GO:0004879	nuclear receptor activity	TAS	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006367	transcription initiation from RNA polymerase II promoter	TAS	biological process
GO:0045652	regulation of megakaryocyte differentiation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061469	regulation of type B pancreatic cell proliferation	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0010613	positive regulation of cardiac muscle hypertrophy	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:1903208	negative regulation of hydrogen peroxide-induced neuron death	IEA	biological process
GO:1903204	negative regulation of oxidative stress-induced neuron death	IEA	biological process
GO:0071870	cellular response to catecholamine stimulus	IEA	biological process
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0050679	positive regulation of epithelial cell proliferation	IEA	biological process
GO:0046321	positive regulation of fatty acid oxidation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0045787	positive regulation of cell cycle	IEA	biological process
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045333	cellular respiration	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0043303	mast cell degranulation	IEA	biological process
GO:0043066	negative regulation of apoptotic process	IEA	biological process
GO:0042472	inner ear morphogenesis	IEA	biological process
GO:0035497	cAMP response element binding	IEA	molecular function
GO:0035035	histone acetyltransferase binding	IEA	molecular function
GO:0021766	hippocampus development	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0043434	response to peptide hormone	IEA	biological process
GO:0035259	glucocorticoid receptor binding	IEA	molecular function
GO:0031100	animal organ regeneration	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:2000253	positive regulation of feeding behavior	IEA	biological process
GO:2000108	positive regulation of leukocyte apoptotic process	IEA	biological process
GO:1900625	positive regulation of monocyte aggregation	IEA	biological process
GO:0097009	energy homeostasis	IEA	biological process
GO:0071376	cellular response to corticotropin-releasing hormone stimulus	IEA	biological process
GO:0060005	vestibular reflex	IEA	biological process
GO:0048752	semicircular canal morphogenesis	IEA	biological process
GO:0048661	positive regulation of smooth muscle cell proliferation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0044320	cellular response to leptin stimulus	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0042542	response to hydrogen peroxide	IEA	biological process
GO:0038097	positive regulation of mast cell activation by Fc-epsilon receptor signaling pathway	IEA	biological process
GO:0035726	common myeloid progenitor cell proliferation	IEA	biological process
GO:0032765	positive regulation of mast cell cytokine production	IEA	biological process
GO:0030534	adult behavior	IEA	biological process
GO:0009444	pyruvate oxidation	IEA	biological process
GO:0007411	axon guidance	IEA	biological process
GO:0007369	gastrulation	IEA	biological process
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0001707	mesoderm formation	IEA	biological process
GO:0001223	transcription coactivator binding	IEA	molecular function
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:1904754	positive regulation of vascular associated smooth muscle cell migration	IGI	biological process
GO:1904707	positive regulation of vascular smooth muscle cell proliferation	IGI	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0043401	steroid hormone mediated signaling pathway	IEA	biological process
GO:0042629	mast cell granule	IEA	cellular component
GO:0042629	mast cell granule	IEA	cellular component
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0030522	intracellular receptor signaling pathway	IEA	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0003677	DNA binding	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05202	Transcriptional misregulation in cancer

Diseases

Associated diseases	References
Extraskeletal myxoid chondrosarcoma	KEGG:H00053
Extraskeletal myxoid chondrosarcoma	KEGG:H00053
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881