• Gene id: 80129

Gene Summary

• Gene Symbol: CCDC170   Gene   UCSC   Ensembl
• Aliases: C6orf97, bA282P11.1
• Gene name: coiled-coil domain containing 170
• Alternate names: coiled-coil domain-containing protein 170,
• Gene location: 6q25.1 (151494016: 151621192)     Exons: 12     NC_000006.12
• Gene summary(Entrez): The function of this gene and its encoded protein is not known. Several genome-wide association studies have implicated the region around this gene to be involved in breast cancer and bone mineral density, but no link to this specific gene has been found.

Protein Summary

• Protein general information: Q8IYT3  
  • Name: Coiled coil domain containing protein 170
  • Length: 715  
  • Mass: 82277
• Sequence:

  MSLDCTSHIALGAASPAPEETYDHLSEVPVTREQLNHYRNVAQNARSELAATLVKFECAQSELQDLRSKMLSKEV
  SCQELKAEMESYKENNARKSSLLTSLRDRVQELEEESAALSTSKIRTEITAHAAIKENQELKKKVVELNEKLQKC
  SKENEENKKQVSKNCRKHEEFLTQLRDCLDPDERNDKASDEDLILKLRDLRKENEFVKGQIVILEETINVHEMEA
  KASRETIMRLASEVNREQKKAASCTEEKEKLNQDLLSAVEAKEALEREVKIFQERLLAGQQVWDASKQEVSLLKK
  SSSELEKSLKASQDAVTTSQSQYFSFREKIAALLRGRLSMTGSTEDTILEKIREMDSREESRDRMVSQLEAQISE
  LVEQLGKESGFHQKALQRAQKAENMLETLQGQLTHLEAELVSGGVLRDNLNFEKQKYLKFLDQLSQKMKLDQMAA
  ELGFDMRLDVVLARTEQLVRLESNAVIENKTIAHNLQRKLKTQKERLESKELHMSLLRQKIAQLEEEKQARTALV
  VERDNAHLTIRNLQKKVERLQKELNTCRDLHTELKAKLADTNELKIKTLEQTKAIEDLNKSRDQLEKMKEKAEKK
  LMSVKSELDTTEHEAKENKERARNMIEVVTSEMKTLKKSLEEAEKREKQLADFREVVSQMLGLNVTSLALPDYEI
  IKCLERLVHSHQHHFVTCACLKDVTTGQERHPQGHLQLLH

• Structural information:
  • Interpro: IPR039139  
  • STRING: ENSP00000239374
• Other Databases: GeneCards:  CCDC170  Malacards:  CCDC170

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008017	microtubule binding	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0000226	microtubule cytoskeleton organization	IDA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component
GO:0036064	ciliary basal body	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R