• Gene id: 80034

Gene Summary

• Gene Symbol: CSRNP3   Gene   UCSC   Ensembl
• Aliases: FAM130A2, PPP1R73, TAIP-2, TAIP2
• Gene name: cysteine and serine rich nuclear protein 3
• Alternate names: cysteine/serine-rich nuclear protein 3, TGF-beta induced apoptosis protein 2, family with sequence similarity 130, member A2, protein phosphatase 1, regulatory subunit 73,
• Gene location: 2q24.3 (4542342: 4418967)     Exons: 14     NC_000004.12

Protein Summary

• Protein general information: Q8WYN3  
  • Name: Cysteine/serine rich nuclear protein 3 (CSRNP 3) (Protein FAM130A2) (TGF beta induced apoptosis protein 2) (TAIP 2)
  • Length: 585  
  • Mass: 64900
• Sequence:

  MSGILKRKFEEVDGSSPCSSVRESDDEVSSSESADSGDSVNPSTSSHFTPSSILKREKRLRTKNVHFSCVTVYYF
  TRRQGFTSVPSQGGSTLGMSSRHNSVRQYTLGEFAREQERLHREMLREHLREEKLNSLKLKMTKNGTVESEEAST
  LTLDDISDDDIDLDNTEVDEYFFLQPLPTKKRRALLRASGVKKIDVEEKHELRAIRLSREDCGCDCRVFCDPDTC
  TCSLAGIKCQVDRMSFPCGCTKEGCSNTAGRIEFNPIRVRTHFLHTIMKLELEKNREQQIPTLNGCHSEISAHSS
  SMGPVAHSVEYSIADSFEIETEPQAAVLHLQSAEELDCQGEEEEEEEDGSSFCSGVTDSSTQSLAPSESDEEEEE
  EEEEEEEEDDDDDKGDGFVEGLGTHAEVVPLPSVLCYSDGTAVHESHAKNASFYANSSTLYYQIDSHIPGTPNQI
  SENYSERDTVKNGTLSLVPYTMTPEQFVDYARQAEEAYGASHYPAANPSVIVCCSSSENDSGVPCNSLYPEHRSN
  HPQVEFHSYLKGPSQEGFVSALNGDSHISEHPAENSLSLAEKSILHEECIKSPVVETVPV

• Structural information:
  • Interpro: IPR031972  IPR023260  
  • STRING: ENSP00000318258
• Other Databases: GeneCards:  CSRNP3  Malacards:  CSRNP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0010923	negative regulation of phosphatase activity	IDA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0043065	positive regulation of apoptotic process	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0003700	DNA-binding transcription factor activity	ISS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq