• Gene id: 80013

Gene Summary

• Gene Symbol: MINDY3   Gene   UCSC   Ensembl
• Aliases: C10orf97, CARP, DERP5, FAM188A, MST126, MSTP126, my042
• Gene name: MINDY lysine 48 deubiquitinase 3
• Alternate names: ubiquitin carboxyl-terminal hydrolase MINDY-3, CARD-containing protein, MINDY deubiquitinase 3, caspase recruitment domain containing pro-apoptotic protein, dermal papilla-derived protein 5, deubiquitinating enzyme MINDY-3, family with sequence similarity 188 m,
• Gene location: 10p13 (15860532: 15778168)     Exons: 19     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene contains a caspase-associated recruitment domain and may function in apoptosis. It has been identified as a tumor suppressor in lung and gastric cancers, and a polymorphism in the gene may be associated with gastric cancer
• OMIM: 611649

Protein Summary

• Protein general information: Q9H8M7  
  • Name: Ubiquitin carboxyl terminal hydrolase MINDY 3 (EC 3.4.19.12) (Dermal papilla derived protein 5) (Deubiquitinating enzyme MINDY 3) (Protein CARP)
  • Length: 445  
  • Mass: 49725
  • Tissue specificity: Widely expressed with high levels in heart, skeletal muscle, and kidney, and low levels in liver and brain (PubMed
• Sequence:

  MSELTKELMELVWGTKSSPGLSDTIFCRWTQGFVFSESEGSALEQFEGGPCAVIAPVQAFLLKKLLFSSEKSSWR
  DCSEEEQKELLCHTLCDILESACCDHSGSYCLVSWLRGKTTEETASISGSPAESSCQVEHSSALAVEELGFERFH
  ALIQKRSFRSLPELKDAVLDQYSMWGNKFGVLLFLYSVLLTKGIENIKNEIEDASEPLIDPVYGHGSQSLINLLL
  TGHAVSNVWDGDRECSGMKLLGIHEQAAVGFLTLMEALRYCKVGSYLKSPKFPIWIVGSETHLTVFFAKDMALVA
  PEAPSEQARRVFQTYDPEDNGFIPDSLLEDVMKALDLVSDPEYINLMKNKLDPEGLGIILLGPFLQEFFPDQGSS
  GPESFTVYHYNGLKQSNYNEKVMYVEGTAVVMGFEDPMLQTDDTPIKRCLQTKWPYIELLWTTDRSPSLN

• Structural information:
  • Interpro: IPR025257  IPR011992  IPR039785  
  • STRING: ENSP00000277632
• Other Databases: GeneCards:  MINDY3  Malacards:  MINDY3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1990380	Lys48-specific deubiquitinase activity	IBA	molecular function
GO:0016807	cysteine-type carboxypeptidase activity	IBA	molecular function
GO:0004843	thiol-dependent ubiquitin-specific protease activity	IDA	molecular function
GO:1990380	Lys48-specific deubiquitinase activity	IDA	molecular function
GO:0006508	proteolysis	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0008233	peptidase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0008234	cysteine-type peptidase activity	IEA	molecular function
GO:0036459	thiol-dependent ubiquitinyl hydrolase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0031965	nuclear membrane	IDA	cellular component
GO:0071108	protein K48-linked deubiquitination	IEA	biological process
GO:0071108	protein K48-linked deubiquitination	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881