• Gene id: 80011

Gene Summary

• Gene Symbol: PSME3IP1   Gene   UCSC   Ensembl
• Aliases: C16orf94, CDA018, CDA10, FAM192A, NIP30, PIP30
• Gene name: proteasome activator subunit 3 interacting protein 1
• Alternate names: PSME3-interacting protein, NEFA-interacting nuclear protein NIP30, PA28G interacting protein 30kDa, PA28G-interacting protein, PSME3 interacting protein 30kDa, family with sequence similarity 192 member A, protein FAM192A,
• Gene location: 16q13 (177170889: 177282421)     Exons: 11     NC_000001.11
• OMIM: 617766

Protein Summary

• Protein general information: Q9GZU8  
  • Name: PSME3 interacting protein (NEFA interacting nuclear protein NIP30) (PA28G interacting protein)
  • Length: 254  
  • Mass: 28912
• Sequence:

  MDGGDDGNLIIKKRFVSEAELDERRKRRQEEWEKVRKPEDPEECPEEVYDPRSLYERLQEQKDRKQQEYEEQFKF
  KNMVRGLDEDETNFLDEVSRQQELIEKQRREEELKELKEYRNNLKKVGISQENKKEVEKKLTVKPIETKNKFSQA
  KLLAGAVKHKSSESGNSVKRLKPDPEPDDKNQEPSSCKSLGNTSLSGPSIHCPSAAVCIGILPGLGAYSGSSDSE
  SSSDSEGTINATGKIVSSIFRTNTFLEAP

• Structural information:
  • Interpro: IPR039845  IPR019331  
  • STRING: ENSP00000335808
• Other Databases: GeneCards:  PSME3IP1  Malacards:  PSME3IP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0032091	negative regulation of protein binding	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:1901799	negative regulation of proteasomal protein catabolic process	IMP	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)