• Gene id: 8001

Gene Summary

• Gene Symbol: GLRA3   Gene   UCSC   Ensembl
• Gene name: glycine receptor alpha 3
• Alternate names: glycine receptor subunit alpha-3, glycine receptor, alpha-3 polypeptide, ligand gated ion channel,
• Gene location: 4q34.1 (174829567: 174636919)     Exons: 13     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the ligand-gated ion channel protein family. The encoded protein is a member of the glycine receptor subfamily. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2013]
• OMIM: 600421

Protein Summary

• Protein general information: O75311  
  • Name: Glycine receptor subunit alpha 3
  • Length: 464  
  • Mass: 53800
  • Tissue specificity: Widely distributed throughout the central nervous system. {ECO
• Sequence:

  MAHVRHFRTLVSGFYFWEAALLLSLVATKETDSARSRSAPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCN
  IFINSFGSIAETTMDYRVNIFLRQKWNDPRLAYSEYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTDNKL
  LRIFKNGNVLYSIRLTLTLSCPMDLKNFPMDVQTCIMQLESFGYTMNDLIFEWQDEAPVQVAEGLTLPQFLLKEE
  KDLRYCTKHYNTGKFTCIEVRFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVALGITTVLTMTTQS
  SGSRASLPKVSYVKAIDIWMAVCLLFVFSALLEYAAVNFVSRQHKELLRFRRKRKNKTEAFALEKFYRFSDMDDE
  VRESRFSFTAYGMGPCLQAKDGMTPKGPNHPVQVMPKSPDEMRKVFIDRAKKIDTISRACFPLAFLIFNIFYWVI
  YKILRHEDIHQQQD

• Structural information:
  • Interpro: IPR006028  IPR008127  IPR008130  IPR006202  IPR036734   IPR006201  IPR036719  IPR006029  IPR018000  
  • Prosite: PS00236
  • PDB: 5CFB 5TIN 5TIO 5VDH 5VDI
  • PDBsum: 5CFB 5TIN 5TIO 5VDH 5VDI
  • DIP: 61773
  • STRING: ENSP00000274093
• Other Databases: GeneCards:  GLRA3  Malacards:  GLRA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IBA	biological process
GO:0007218	neuropeptide signaling pathway	IBA	biological process
GO:0007268	chemical synaptic transmission	IBA	biological process
GO:0016594	glycine binding	IBA	contributes to
GO:0043005	neuron projection	IBA	cellular component
GO:0050877	nervous system process	IBA	biological process
GO:0060012	synaptic transmission, glycinergic	IBA	biological process
GO:1902476	chloride transmembrane transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0030594	neurotransmitter receptor activity	IBA	molecular function
GO:0034220	ion transmembrane transport	IBA	biological process
GO:0042391	regulation of membrane potential	IBA	biological process
GO:0043200	response to amino acid	IBA	biological process
GO:0045202	synapse	IBA	cellular component
GO:0005254	chloride channel activity	IBA	contributes to
GO:1902476	chloride transmembrane transport	IDA	biological process
GO:0022852	glycine-gated chloride ion channel activity	IDA	molecular function
GO:0016935	glycine-gated chloride channel complex	IDA	cellular component
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0016934	extracellularly glycine-gated chloride channel activity	IDA	molecular function
GO:0051260	protein homooligomerization	IDA	biological process
GO:0005887	integral component of plasma membrane	IMP	cellular component
GO:0005230	extracellular ligand-gated ion channel activity	IEA	molecular function
GO:0006821	chloride transport	IEA	biological process
GO:0016594	glycine binding	IEA	molecular function
GO:0022824	transmitter-gated ion channel activity	IEA	molecular function
GO:0004888	transmembrane signaling receptor activity	IEA	molecular function
GO:0005216	ion channel activity	IEA	molecular function
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016934	extracellularly glycine-gated chloride channel activity	IEA	molecular function
GO:0034220	ion transmembrane transport	IEA	biological process
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0006821	chloride transport	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0034707	chloride channel complex	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005254	chloride channel activity	IEA	molecular function
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0060079	excitatory postsynaptic potential	IEA	biological process
GO:0060079	excitatory postsynaptic potential	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04080	Neuroactive ligand-receptor interaction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq