• Gene id: 8000

Gene Summary

• Gene Symbol: PSCA   Gene   UCSC   Ensembl
• Aliases: PRO232
• Gene name: prostate stem cell antigen
• Alternate names: prostate stem cell antigen,
• Gene location: 8q24.3 (142670296: 142682724)     Exons: 4     NC_000008.11
• Gene summary(Entrez): This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large pro
• OMIM: 606027

Protein Summary

• Protein general information: O43653  
  • Name: Prostate stem cell antigen
  • Length: 114  
  • Mass: 11959
  • Tissue specificity: Highly expressed in prostate (basal, secretory and neuroendocrine epithelium cells). Also found in bladder (transitional epithelium), placenta (trophoblasts), stomach (neuroendocrine cells), colon (neuroendocrine cells) and kidney (col
• Sequence:

  MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNI
  TCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL

• Structural information:
  • Protein Domains: (12..8-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR016054  
  • STRING: ENSP00000301258
• Other Databases: GeneCards:  PSCA  Malacards:  PSCA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016020	membrane	IBA	cellular component
GO:0031225	anchored component of membrane	IBA	cellular component
GO:0033130	acetylcholine receptor binding	IDA	molecular function
GO:0099601	regulation of neurotransmitter receptor activity	IDA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881