• Gene id: 79991

Gene Summary

• Gene Symbol: STN1   Gene   UCSC   Ensembl
• Aliases: AAF-44, AAF44, OBFC1, RPA-32, bA541N10.2
• Gene name: STN1 subunit of CST complex
• Alternate names: CST complex subunit STN1, STN1, CST complex subunit, alpha accessory factor 44, oligonucleotide/oligosaccharide binding fold containing 1, oligonucleotide/oligosaccharide-binding fold-containing protein 1, replication protein A 32 kDa subunit, suppressor of cdc,
• Gene location: 10q24.33 (103918183: 103877568)     Exons: 10     NC_000010.11
• Gene summary(Entrez): OBFC1 and C17ORF68 (MIM 613129) are subunits of an alpha accessory factor (AAF) that stimulates the activity of DNA polymerase-alpha-primase (see MIM 176636), the enzyme that initiates DNA replication (Casteel et al., 2009 [PubMed 19119139]). OBFC1 also a
• OMIM: 158380

Protein Summary

• Protein general information: Q9H668  
  • Name: CST complex subunit STN1 (Oligonucleotide/oligosaccharide binding fold containing protein 1) (Suppressor of cdc thirteen homolog)
  • Length: 368  
  • Mass: 42119
• Sequence:

  MQPGSSRCEEETPSLLWGLDPVFLAFAKLYIRDILDMKESRQVPGVFLYNGHPIKQVDVLGTVIGVRERDAFYSY
  GVDDSTGVINCICWKKLNTESVSAAPSAARELSLTSQLKKLQETIEQKTKIEIGDTIRVRGSIRTYREEREIHAT
  TYYKVDDPVWNIQIARMLELPTIYRKVYDQPFHSSALEKEEALSNPGALDLPSLTSLLSEKAKEFLMENRVQSFY
  QQELEMVESLLSLANQPVIHSASSDQVNFKKDTTSKAIHSIFKNAIQLLQEKGLVFQKDDGFDNLYYVTREDKDL
  HRKIHRIIQQDCQKPNHMEKGCHFLHILACARLSIRPGLSEAVLQQVLELLEDQSDIVSTMEHYYTAF

• Structural information:
  • Interpro: IPR015253  IPR042082  IPR012340  IPR004365  IPR040260   IPR014647  IPR036388  IPR036390  
  • PDB: 4JOI 4JQF
  • PDBsum: 4JOI 4JQF
  • DIP: 59914
  • STRING: ENSP00000224950
• Other Databases: GeneCards:  STN1  Malacards:  STN1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006289	nucleotide-excision repair	IBA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0006260	DNA replication	IBA	biological process
GO:0000781	chromosome, telomeric region	IBA	cellular component
GO:0035861	site of double-strand break	IBA	cellular component
GO:0005662	DNA replication factor A complex	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003697	single-stranded DNA binding	IBA	molecular function
GO:0000724	double-strand break repair via homologous recombination	IBA	biological process
GO:0043047	single-stranded telomeric DNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0000784	nuclear chromosome, telomeric region	IDA	cellular component
GO:0010833	telomere maintenance via telomere lengthening	IMP	biological process
GO:0000723	telomere maintenance	IMP	biological process
GO:0045740	positive regulation of DNA replication	ISS	biological process
GO:0005634	nucleus	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003697	single-stranded DNA binding	ISS	molecular function
GO:0016233	telomere capping	IEA	biological process
GO:1990879	CST complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0043047	single-stranded telomeric DNA binding	IEA	molecular function
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0042162	telomeric DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003697	single-stranded DNA binding	IEA	molecular function
GO:0000784	nuclear chromosome, telomeric region	IEA	cellular component
GO:1990879	CST complex	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1990879	CST complex	IDA	cellular component
GO:0042162	telomeric DNA binding	IDA	molecular function
GO:1990879	CST complex	IDA	cellular component
GO:0032211	negative regulation of telomere maintenance via telomerase	IDA	biological process
GO:0000784	nuclear chromosome, telomeric region	HDA	cellular component
GO:0016233	telomere capping	TAS	biological process
GO:0000781	chromosome, telomeric region	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045111	intermediate filament cytoskeleton	IDA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component

Diseases

Associated diseases	References
Coats plus syndrome	KEGG:H02251
Coats plus syndrome	KEGG:H02251
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq