• Gene id: 79989

Gene Summary

• Gene Symbol: TTC26   Gene   UCSC   Ensembl
• Aliases: DYF13, IFT56, dyf-13
• Gene name: tetratricopeptide repeat domain 26
• Alternate names: intraflagellar transport protein 56, TPR repeat protein 26, tetratricopeptide repeat protein 26,
• Gene location: 7q34 (139133743: 139191985)     Exons: 19     NC_000007.14
• OMIM: 617453

Protein Summary

• Protein general information: A0AVF1  
  • Name: Intraflagellar transport protein 56 (Tetratricopeptide repeat protein 26) (TPR repeat protein 26)
  • Length: 554  
  • Mass: 64178
• Sequence:

  MMLSRAKPAVGRGVQHTDKRKKKGRKIPKLEELLSKRDFTGAITLLEFKRHVGEEEEDTNLWIGYCAFHLGDYKR
  ALEEYENATKEENCNSEVWVNLACTYFFLGMYKQAEAAGFKASKSRLQNRLLFHLAHKFNDEKKLMSFHQNLQDV
  TEDQLSLASIHYMRSHYQEAIDIYKRILLDNREYLALNVYVALCYYKLDYYDVSQEVLAVYLQQIPDSTIALNLK
  ACNHFRLYNGRAAEAELKSLMDNASSSFEFAKELIRHNLVVFRGGEGALQVLPPLVDVIPEARLNLVIYYLRQDD
  VQEAYNLIKDLEPTTPQEYILKGVVNAALGQEMGSRDHMKIAQQFFQLVGGSASECDTIPGRQCMASCFFLLKQF
  DDVLIYLNSFKSYFYNDDIFNFNYAQAKAATGNTSEGEEAFLLIQSEKMKNDYIYLSWLARCYIMNKKPRLAWEL
  YLKMETSGESFSLLQLIANDCYKMGQFYYSAKAFDVLERLDPNPEYWEGKRGACVGIFQMIIAGREPKETLREVL
  HLLRSTGNTQVEYMIRIMKKWAKENRVSI

• Structural information:
  • Interpro: IPR013026  IPR011990  IPR019734  IPR030511  
  • Prosite: PS50293
  • STRING: ENSP00000419279
• Other Databases: GeneCards:  TTC26  Malacards:  TTC26

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035720	intraciliary anterograde transport	IBA	biological process
GO:0036064	ciliary basal body	IBA	cellular component
GO:0097546	ciliary base	IBA	cellular component
GO:0030992	intraciliary transport particle B	IBA	cellular component
GO:0035735	intraciliary transport involved in cilium assembly	IBA	biological process
GO:0120170	intraciliary transport particle B binding	IBA	molecular function
GO:0042073	intraciliary transport	ISS	biological process
GO:0060271	cilium assembly	ISS	biological process
GO:0030992	intraciliary transport particle B	ISS	cellular component
GO:0007224	smoothened signaling pathway	ISS	biological process
GO:0005929	cilium	ISS	cellular component
GO:0061512	protein localization to cilium	ISS	biological process
GO:0035082	axoneme assembly	ISS	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0005929	cilium	TAS	cellular component
GO:0035735	intraciliary transport involved in cilium assembly	TAS	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0060271	cilium assembly	IEA	biological process
GO:0042073	intraciliary transport	IEA	biological process
GO:0036064	ciliary basal body	IEA	cellular component
GO:0007286	spermatid development	IEA	biological process
GO:0005813	centrosome	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:1905198	manchette assembly	IEA	biological process
GO:0120170	intraciliary transport particle B binding	IEA	molecular function
GO:0061512	protein localization to cilium	IEA	biological process
GO:0035082	axoneme assembly	IEA	biological process
GO:0030992	intraciliary transport particle B	IEA	cellular component
GO:0007224	smoothened signaling pathway	IEA	biological process
GO:0005929	cilium	IEA	cellular component
GO:0005929	cilium	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881