• Gene id: 79982

Gene Summary

• Gene Symbol: DNAJB14   Gene   UCSC   Ensembl
• Aliases: EGNR9427, PRO34683
• Gene name: DnaJ heat shock protein family (Hsp40) member B14
• Alternate names: dnaJ homolog subfamily B member 14, DnaJ (Hsp40) homolog, subfamily B, member 14,
• Gene location: 4q23 (99946712: 99896247)     Exons: 2     NC_000004.12
• OMIM: 617487

Protein Summary

• Protein general information: Q8TBM8  
  • Name: DnaJ homolog subfamily B member 14
  • Length: 379  
  • Mass: 42516
• Sequence:

  MEGNRDEAEKCVEIAREALNAGNREKAQRFLQKAEKLYPLPSARALLEIIMKNGSTAGNSPHCRKPSGSGDQSKP
  NCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDEDLKKAYRKLALKFHPDKNHAPGATDAFK
  KIGNAYAVLSNPEKRKQYDLTGNEEQACNHQNNGRFNFHRGCEADITPEDLFNIFFGGGFPSGSVHSFSNGRAGY
  SQQHQHRHSGHEREEERGDGGFSVFIQLMPIIVLILVSLLSQLMVSNPPYSLYPRSGTGQTIKMQTENLGVVYYV
  NKDFKNEYKGMLLQKVEKSVEEDYVTNIRNNCWKERQQKTDMQYAAKVYRDDRLRRKADALSMDNCKELERLTSL
  YKGG

• Structural information:
  • Protein Domains: (108..17-)
    (/note="J-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00286"-)
  • Interpro: IPR001623  IPR018253  IPR015399  IPR036869  
  • Prosite: PS00636 PS50076
  • CDD: cd06257
  • STRING: ENSP00000404381
• Other Databases: GeneCards:  DNAJB14  Malacards:  DNAJB14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0071218	cellular response to misfolded protein	IBA	biological process
GO:0051085	chaperone cofactor-dependent protein refolding	IBA	biological process
GO:0005789	endoplasmic reticulum membrane	IBA	cellular component
GO:0030544	Hsp70 protein binding	IBA	molecular function
GO:0030433	ubiquitin-dependent ERAD pathway	IBA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0051085	chaperone cofactor-dependent protein refolding	IDA	biological process
GO:0034622	cellular protein-containing complex assembly	IDA	biological process
GO:0030544	Hsp70 protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0031965	nuclear membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)