• Gene id: 79971

Gene Summary

• Gene Symbol: WLS   Gene   UCSC   Ensembl
• Aliases: C1orf139, EVI, GPR177, MRP, mig-14
• Gene name: Wnt ligand secretion mediator
• Alternate names: protein wntless homolog, G protein-coupled receptor 177, integral membrane protein GPR177, protein evenness interrupted homolog, putative NF-kappa-B-activating protein 373, putative NFkB activating protein 373, wntless Wnt ligand secretion mediator,
• Gene location: 1p31.3 (31457505: 31446035)     Exons: 3     NC_000014.9
• OMIM: 611514

Protein Summary

• Protein general information: Q5T9L3  
  • Name: Protein wntless homolog (Integral membrane protein GPR177) (Protein evenness interrupted homolog) (EVI) (Putative NF kappa B activating protein 373)
  • Length: 541  
  • Mass: 62253
• Sequence:

  MAGAIIENMSTKKLCIVGGILLVFQIIAFLVGGLIAPGPTTAVSYMSVKCVDARKNHHKTKWFVPWGPNHCDKIR
  DIEEAIPREIEANDIVFSVHIPLPHMEMSPWFQFMLFILQLDIAFKLNNQIRENAEVSMDVSLAYRDDAFAEWTE
  MAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKDIRLVGIH
  QNGGFTKVWFAMKTFLTPSIFIIMVWYWRRITMMSRPPVLLEKVIFALGISMTFINIPVEWFSIGFDWTWMLLFG
  DIRQGIFYAMLLSFWIIFCGEHMMDQHERNHIAGYWKQVGPIAVGSFCLFIFDMCERGVQLTNPFYSIWTTDIGT
  ELAMAFIIVAGICLCLYFLFLCFMVFQVFRNISGKQSSLPAMSKVRRLHYEGLIFRFKFLMLITLACAAMTVIFF
  IVSQVTEGHWKWGGVTVQVNSAFFTGIYGMWNLYVFALMFLYAPSHKNYGEDQSNGDLGVHSGEELQLTTTITHV
  DGPTEIYKLTRKEAQE

• Structural information:
  • Interpro: IPR009551  
  • STRING: ENSP00000346829
• Other Databases: GeneCards:  WLS  Malacards:  WLS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0017147	Wnt-protein binding	ISS	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:0030177	positive regulation of Wnt signaling pathway	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006886	intracellular protein transport	IMP	biological process
GO:0061357	positive regulation of Wnt protein secretion	ISS	biological process
GO:0061357	positive regulation of Wnt protein secretion	IMP	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0031301	integral component of organelle membrane	IBA	cellular component
GO:0061355	Wnt protein secretion	IBA	biological process
GO:0016055	Wnt signaling pathway	ISS	biological process
GO:0009948	anterior/posterior axis specification	ISS	biological process
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0016055	Wnt signaling pathway	TAS	biological process
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0030666	endocytic vesicle membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0070062	extracellular exosome	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017147	Wnt-protein binding	IPI	molecular function
GO:0061355	Wnt protein secretion	IMP	biological process
GO:0031852	mu-type opioid receptor binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016055	Wnt signaling pathway	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0032839	dendrite cytoplasm	IEA	cellular component
GO:0032590	dendrite membrane	IEA	cellular component
GO:0090263	positive regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0031017	exocrine pancreas development	IEA	biological process
GO:0030902	hindbrain development	IEA	biological process
GO:0030901	midbrain development	IEA	biological process
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0009948	anterior/posterior axis specification	IEA	biological process
GO:0001707	mesoderm formation	IEA	biological process
GO:0090263	positive regulation of canonical Wnt signaling pathway	IMP	biological process
GO:0031901	early endosome membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq