• Gene id: 79931

Gene Summary

• Gene Symbol: TNIP3   Gene   UCSC   Ensembl
• Aliases: ABIN-3, LIND
• Gene name: TNFAIP3 interacting protein 3
• Alternate names: TNFAIP3-interacting protein 3, A20-binding inhibitor of NF-kappa-B activation 3, ABIN-3 beta, Listeria induced, TNFAIP3-interacting protein 3 beta, TNIP3 beta, listeria-induced gene protein,
• Gene location: 4q27 (32628034: 32821050)     Exons: 20     NC_000002.12
• OMIM: 608019

Protein Summary

• Protein general information: Q96KP6  
  • Name: TNFAIP3 interacting protein 3 (A20 binding inhibitor of NF kappa B activation 3) (ABIN 3) (Listeria induced gene protein)
  • Length: 325  
  • Mass: 38943
  • Tissue specificity: Highly expressed in lung, lymph node, thymus and fetal liver. Expressed at lower levels in bone marrow, brain, kidney, spleen, leukocytes and tonsils. Could be detected in heart, salivary gland, adrenal gland, pancreas, ovary and fetal
• Sequence:

  MAHFVQGTSRMIAAESSTEHKECAEPSTRKNLMNSLEQKIRCLEKQRKELLEVNQQWDQQFRSMKELYERKVAEL
  KTKLDAAERFLSTREKDPHQRQRKDDRQREDDRQRDLTRDRLQREEKEKERLNEELHELKEENKLLKGKNTLANK
  EKEHYECEIKRLNKALQDALNIKCSFSEDCLRKSRVEFCHEEMRTEMEVLKQQVQIYEEDFKKERSDRERLNQEK
  EELQQINETSQSQLNRLNSQIKACQMEKEKLEKQLKQMYCPPCNCGLVFHLQDPWVPTGPGAVQKQREHPPDYQW
  YALDQLPPDVQHKANGLSSVKKVHP

• Structural information:
  • Interpro: IPR032419  IPR033574  
  • STRING: ENSP00000426613
• Other Databases: GeneCards:  TNIP3  Malacards:  TNIP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0031593	polyubiquitin modification-dependent protein binding	IBA	molecular function
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0071222	cellular response to lipopolysaccharide	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0031593	polyubiquitin modification-dependent protein binding	IDA	molecular function
GO:0002756	MyD88-independent toll-like receptor signaling pathway	IDA	biological process
GO:0034142	toll-like receptor 4 signaling pathway	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0071222	cellular response to lipopolysaccharide	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)