• Gene id: 79921

Gene Summary

• Gene Symbol: TCEAL4   Gene   UCSC   Ensembl
• Aliases: NPD017, WEX7
• Gene name: transcription elongation factor A like 4
• Alternate names: transcription elongation factor A protein-like 4, TCEA-like protein 4, epididymis secretory sperm binding protein, transcription elongation factor A (SII)-like 4, transcription elongation factor S-II protein-like 4,
• Gene location: Xq22.2 (103576230: 103587735)     Exons: 7     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. This family is comprised of nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. Multiple family members are located

Protein Summary

• Protein general information: Q96EI5  
  • Name: Transcription elongation factor A protein like 4 (TCEA like protein 4) (Transcription elongation factor S II protein like 4)
  • Length: 215  
  • Mass: 24647
• Sequence:

  MEKLYSENEGMASNQGKMENEEQPQDERKPEVTCTLEDKKLENEGKTENKGKTGDEEMLKDKGKPESEGEAKEGK
  SEREGESEMEGGSEREGKPEIEGKPESEGEPGSETRAAGKRPAEDDVPRKAKRKTNKGLAHYLKEYKEAIHDMNF
  SNEDMIREFDNMAKVQDEKRKSKQKLGAFLWMQRNLQDPFYPRGPREFRGGCRAPRRDIEDIPYV

• Structural information:
  • Interpro: IPR021156  
  • STRING: ENSP00000361712
• Other Databases: GeneCards:  TCEAL4  Malacards:  TCEAL4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R