• Gene id: 79913

Gene Summary

• Gene Symbol: ACTR5   Gene   UCSC   Ensembl
• Aliases: Arp5, INO80M
• Gene name: actin related protein 5
• Alternate names: actin-related protein 5, ARP5 actin related protein 5 homolog, INO80 complex subunit M, hARP5, sarcoma antigen NY-SAR-16,
• Gene location: 20q11.23 (38748459: 38772519)     Exons: 9     NC_000020.11
• OMIM: 614647

Protein Summary

• Protein general information: Q9H9F9  
  • Name: Actin related protein 5 (hARP5) (Sarcoma antigen NY SAR 16)
  • Length: 607  
  • Mass: 68297
• Sequence:

  MAANVFPFRDARAAPDPVLEAGPVAHGPLPVPLVLDNGSFQVRAGWACPGQDPGPEPRLQFRAVCARGRGGARGA
  SGPQVGNALGSLEPLRWMLRSPFDRNVPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSE
  LLFECYGIPKVAYGIDSLFSFYHNKPKNSMCSGLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRL
  LQLKYPGHLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLLGSTLTSEEKQERRQQ
  QLRRLQELNARRREEKLQLDQERLDRLLYVQELLEDGQMDQFHKALIELNMDSPEELQSYIQKLSIAVEQAKQKI
  LQAEVNLEVDVVDSKPETPDLEQLEPSLEDVESMNDFDPLFSEETPGVEKPVTTVQPVFNLAAYHQLFVGTERIR
  APEIIFQPSLIGEEQAGIAETLQYILDRYPKDIQEMLVQNVFLTGGNTMYPGMKARMEKELLEMRPFRSSFQVQL
  ASNPVLDAWYGARDWALNHLDDNEVWITRKEYEEKGGEYLKEHCASNIYVPIRLPKQASRSSDAQASSKGSAAGG
  GGAGEQA

• Structural information:
  • Interpro: IPR004000  IPR004001  IPR027664  
  • Prosite: PS00432
  • PDB: 6HTS
  • PDBsum: 6HTS
  • DIP: 34297
  • STRING: ENSP00000243903
• Other Databases: GeneCards:  ACTR5  Malacards:  ACTR5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043044	ATP-dependent chromatin remodeling	IBA	biological process
GO:0031011	Ino80 complex	IBA	cellular component
GO:0006355	regulation of transcription, DNA-templated	IBA	biological process
GO:0006302	double-strand break repair	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0031011	Ino80 complex	IDA	cellular component
GO:0031011	Ino80 complex	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0070914	UV-damage excision repair	IMP	biological process
GO:0006302	double-strand break repair	IMP	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006310	DNA recombination	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0016579	protein deubiquitination	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray