• Gene id: 79903

Gene Summary

• Gene Symbol: NAA60   Gene   UCSC   Ensembl
• Aliases: HAT4, NAT15, NatF, hNaa60
• Gene name: N-alpha-acetyltransferase 60, NatF catalytic subunit
• Alternate names: N-alpha-acetyltransferase 60, N-acetyltransferase 15 (GCN5-related, putative), N-alpha-acetyltransferase F, epididymis secretory sperm binding protein, histone acetyltransferase type B protein 4,
• Gene location: 16p13.3 (3443610: 3486962)     Exons: 9     NC_000016.10
• Gene summary(Entrez): This gene encodes an enzyme that localizes to the Golgi apparatus, where it transfers an acetyl group to the N-terminus of free proteins. This enzyme acts on histones, and its activity is important for chromatin assembly and chromosome integrity. Alternat
• OMIM: 602997

Protein Summary

• Protein general information: Q9H7X0  
  • Name: N alpha acetyltransferase 60 (hNaa60) (EC 2.3.1.259) (Histone acetyltransferase type B protein 4) (HAT4) (EC 2.3.1.48) (N acetyltransferase 15) (N alpha acetyltransferase F) (NatF)
  • Length: 242  
  • Mass: 27451
• Sequence:

  MTEVVPSSALSEVSLRLLCHDDIDTVKHLCGDWFPIEYPDSWYRDITSNKKFFSLAATYRGAIVGMIVAEIKNRT
  KIHKEDGDILASNFSVDTQVAYILSLGVVKEFRKHGIGSLLLESLKDHISTTAQDHCKAIYLHVLTTNNTAINFY
  ENRDFKQHHYLPYYYSIRGVLKDGFTYVLYINGGHPPWTILDYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFL
  PWSGISSKSGIEYSRTM

• Structural information:
  • Protein Domains: (13..18-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
  • Interpro: IPR016181  IPR000182  
  • Prosite: PS51186
  • PDB: 5HGZ 5HH0 5HH1 5ICV 5ICW
  • PDBsum: 5HGZ 5HH0 5HH1 5ICV 5ICW
  • DIP: 62077
  • STRING: ENSP00000385903
• Other Databases: GeneCards:  NAA60  Malacards:  NAA60

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004596	peptide alpha-N-acetyltransferase activity	IBA	molecular function
GO:0004402	histone acetyltransferase activity	IBA	molecular function
GO:0000139	Golgi membrane	IBA	cellular component
GO:0043967	histone H4 acetylation	IBA	biological process
GO:0043966	histone H3 acetylation	IBA	biological process
GO:0017196	N-terminal peptidyl-methionine acetylation	IBA	biological process
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	molecular function
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	molecular function
GO:0000139	Golgi membrane	IDA	cellular component
GO:0010485	H4 histone acetyltransferase activity	IDA	molecular function
GO:0006334	nucleosome assembly	IDA	biological process
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	molecular function
GO:0000139	Golgi membrane	IDA	cellular component
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0008283	cell population proliferation	IMP	biological process
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0007059	chromosome segregation	IEA	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0004596	peptide alpha-N-acetyltransferase activity	IDA	molecular function
GO:0017196	N-terminal peptidyl-methionine acetylation	IDA	biological process
GO:0007059	chromosome segregation	ISS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray