• Gene id: 79901

Gene Summary

• Gene Symbol: CYBRD1   Gene   UCSC   Ensembl
• Aliases: CYB561A2, DCYTB, FRRS3
• Gene name: cytochrome b reductase 1
• Alternate names: cytochrome b reductase 1, cytochrome b561 family, member A2, duodenal cytochrome b, ferric-chelate reductase 3,
• Gene location: 2q31.1 (171522232: 171558128)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorpti
• OMIM: 302020

Protein Summary

• Protein general information: Q53TN4  
  • Name: Cytochrome b reductase 1 (EC 1. . . ) (Duodenal cytochrome b) (Ferric chelate reductase 3)
  • Length: 286  
  • Mass: 31641
  • Tissue specificity: Present in erythrocyte membranes (at protein level). Also expressed in respiratory epithelium. {ECO
• Sequence:

  MAMEGYWRFLALLGSALLVGFLSVIFALVWVLHYREGLGWDGSALEFNWHPVLMVTGFVFIQGIAIIVYRLPWTW
  KCSKLLMKSIHAGLNAVAAILAIISVVAVFENHNVNNIANMYSLHSWVGLIAVICYLLQLLSGFSVFLLPWAPLS
  LRAFLMPIHVYSGIVIFGTVIATALMGLTEKLIFSLRDPAYSTFPPEGVFVNTLGLLILVFGALIFWIVTRPQWK
  RPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM

• Structural information:
  • Protein Domains: (15..22-)
    (/note="Cytochrome-b561)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00242"-)
  • Interpro: IPR028838  IPR006593  
  • Prosite: PS50939
  • PDB: 5ZLE 5ZLG
  • PDBsum: 5ZLE 5ZLG
  • STRING: ENSP00000319141
• Other Databases: GeneCards:  CYBRD1  Malacards:  CYBRD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000293	ferric-chelate reductase activity	IDA	molecular function
GO:0005765	lysosomal membrane	IBA	cellular component
GO:0016491	oxidoreductase activity	IBA	molecular function
GO:0000293	ferric-chelate reductase activity	IEA	molecular function
GO:0010039	response to iron ion	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0031526	brush border membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006879	cellular iron ion homeostasis	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031526	brush border membrane	IEA	cellular component
GO:0010039	response to iron ion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04978	Mineral absorption

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R