• Gene id: 79897

Gene Summary

• Gene Symbol: RPP21   Gene   UCSC   Ensembl
• Aliases: C6orf135, CAT60
• Gene name: ribonuclease P/MRP subunit p21
• Alternate names: ribonuclease P protein subunit p21, RNaseP protein p21, ribonuclease P/MRP 21kDa subunit, ribonucleoprotein V,
• Gene location: 6p22.1 (30345155: 30346893)     Exons: 5     NC_000006.12
• Gene summary(Entrez): RPP21 is a protein subunit of nuclear ribonuclease P, which processes the 5-prime leader sequence of precursor tRNAs (Jarrous et al., 2001 [PubMed 11497433]).[supplied by OMIM, Jan 2009]

Protein Summary

• Protein general information: Q9H633  
  • Name: Ribonuclease P protein subunit p21 (RNaseP protein p21) (EC 3.1.26.5) (Ribonuclease P/MRP 21 kDa subunit) (Ribonucleoprotein V)
  • Length: 154  
  • Mass: 17570
• Sequence:

  MAGPVKDREAFQRLNFLYQAAHCVLAQDPENQALARFYCYTERTIAKRLVLRRDPSVKRTLCRGCSSLLVPGLTC
  TQRQRRCRGQRWTVQTCLTCQRSQRFLNDPGHLLWGDRPEAQLGSQADSKPLQPLPNTAHSISDRLPEEKMQTQG
  SSNQ

• Structural information:
  • Interpro: IPR007175  
  • PDB: 6AHR 6AHU
  • PDBsum: 6AHR 6AHU
  • STRING: ENSP00000409799
• Other Databases: GeneCards:  RPP21  Malacards:  RPP21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004526	ribonuclease P activity	IBA	contributes to
GO:0005655	nucleolar ribonuclease P complex	IBA	cellular component
GO:0008033	tRNA processing	IBA	biological process
GO:0033204	ribonuclease P RNA binding	IDA	molecular function
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0008033	tRNA processing	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004526	ribonuclease P activity	IEA	molecular function
GO:0004526	ribonuclease P activity	IDA	contributes to
GO:0001682	tRNA 5'-leader removal	IDA	biological process
GO:0030681	multimeric ribonuclease P complex	IDA	cellular component
GO:0001682	tRNA 5'-leader removal	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090502	RNA phosphodiester bond hydrolysis, endonucleolytic	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0090501	RNA phosphodiester bond hydrolysis	IEA	biological process
GO:0042493	response to drug	IEP	biological process

KEGG pathways

Pathway id	Pathway name
hsa03013	RNA transport

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881