• Gene id: 79888

Gene Summary

• Gene Symbol: LPCAT1   Gene   UCSC   Ensembl
• Aliases: AGPAT10, AGPAT9, AYTL2, LPCAT-1, PFAAP3, lpcat, lysoPAFAT
• Gene name: lysophosphatidylcholine acyltransferase 1
• Alternate names: lysophosphatidylcholine acyltransferase 1, 1-acylglycerophosphocholine O-acyltransferase, 1-alkylglycerophosphocholine O-acetyltransferase, LPC acyltransferase 1, acetyl-CoA:lyso-PAF acetyltransferase, acetyl-CoA:lyso-platelet-activating factor acetyltransfera,
• Gene location: 5p15.33 (1523959: 1461426)     Exons: 18     NC_000005.10
• Gene summary(Entrez): This gene encodes a member of the 1-acyl-sn-glycerol-3-phosphate acyltransferase family of proteins. The encoded enzyme plays a role in phospholipid metabolism, specifically in the conversion of lysophosphatidylcholine to phosphatidylcholine in the presen
• OMIM: 602758

Protein Summary

• Protein general information: Q8NF37  
  • Name: Lysophosphatidylcholine acyltransferase 1 (LPC acyltransferase 1) (LPCAT 1) (LysoPC acyltransferase 1) (EC 2.3.1.23) (1 acylglycerophosphocholine O acyltransferase) (1 alkylglycerophosphocholine O acetyltransferase) (EC 2.3.1.67) (Acetyl CoA:lyso platelet
  • Length: 534  
  • Mass: 59151
• Sequence:

  MRLRGCGPRAAPASSAGASDARLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVA
  SLGSAEKEPEQPPALWRKVVDFLLKAIMRTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVTMTMSS
  IVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAF
  IPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAE
  ALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAAS
  LEVPVSDLLEDMFSLFDESGSGEVDLRECVVALSVVCRPARTLDTIQLAFKMYGAQEDGSVGEGDLSCILKTALG
  VAELTVTDLFRAIDQEEKGKITFADFHRFAEMYPAFAEEYLYPDQTHFESCAETSPAPIPNGFCADFSPENSDAG
  RKPVRKKLD

• Structural information:
  • Protein Domains: (379..41-)
    (/note="EF-hand-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448-)
    (451..48-)
    (/note="EF-hand-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00448"-)
  • Interpro: IPR011992  IPR002048  IPR002123  
  • Prosite: PS50222
  • STRING: ENSP00000283415
• Other Databases: GeneCards:  LPCAT1  Malacards:  LPCAT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IDA	molecular function
GO:0036151	phosphatidylcholine acyl-chain remodeling	IDA	biological process
GO:0005811	lipid droplet	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IDA	molecular function
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	ISS	molecular function
GO:0047192	1-alkylglycerophosphocholine O-acetyltransferase activity	ISS	molecular function
GO:0047159	1-alkenylglycerophosphocholine O-acyltransferase activity	ISS	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005811	lipid droplet	IEA	cellular component
GO:0016740	transferase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0003841	1-acylglycerol-3-phosphate O-acyltransferase activity	IEA	molecular function
GO:0047192	1-alkylglycerophosphocholine O-acetyltransferase activity	IEA	molecular function
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0047159	1-alkenylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0050200	plasmalogen synthase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0035577	azurophil granule membrane	TAS	cellular component
GO:0036148	phosphatidylglycerol acyl-chain remodeling	TAS	biological process
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006654	phosphatidic acid biosynthetic process	TAS	biological process
GO:0006656	phosphatidylcholine biosynthetic process	TAS	biological process
GO:0036151	phosphatidylcholine acyl-chain remodeling	TAS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0043129	surfactant homeostasis	IEA	biological process
GO:0045732	positive regulation of protein catabolic process	IEA	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0047191	1-alkylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0008654	phospholipid biosynthetic process	IEA	biological process
GO:0047159	1-alkenylglycerophosphocholine O-acyltransferase activity	IEA	molecular function
GO:2001246	negative regulation of phosphatidylcholine biosynthetic process	IEA	biological process
GO:0005811	lipid droplet	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005811	lipid droplet	IDA	cellular component
GO:0006644	phospholipid metabolic process	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0008654	phospholipid biosynthetic process	ISS	biological process
GO:0047184	1-acylglycerophosphocholine O-acyltransferase activity	ISS	molecular function
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:0005794	Golgi apparatus	ISS	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00564	Glycerophospholipid metabolism
hsa00565	Ether lipid metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray