• Gene id: 79885

Gene Summary

• Gene Symbol: HDAC11   Gene   UCSC   Ensembl
• Aliases: HD11
• Gene name: histone deacetylase 11
• Alternate names: histone deacetylase 11,
• Gene location: 3p25.1 (13478902: 13506415)     Exons: 14     NC_000003.12
• Gene summary(Entrez): This gene encodes a class IV histone deacetylase. The encoded protein is localized to the nucleus and may be involved in regulating the expression of interleukin 10. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Apr 200
• OMIM: 607226

Protein Summary

• Protein general information: Q96DB2  
  • Name: Histone deacetylase 11 (HD11) (EC 3.5.1.98)
  • Length: 347  
  • Mass: 39183
  • Tissue specificity: Weakly expressed in most tissues. Strongly expressed in brain, heart, skeletal muscle, kidney and testis.
• Sequence:

  MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSMLVEAREASEEDLLVVH
  TRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGGTIMAGKLAVERGWAINVGGGFHHCSSDRGG
  GFCAYADITLAIKFLFERVEGISRATIIDLDAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVEL
  EWGTEDDEYLDKVERNIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
  SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP

• Structural information:
  • Interpro: IPR000286  IPR023801  IPR037138  IPR023696  
  • STRING: ENSP00000295757
• Other Databases: GeneCards:  HDAC11  Malacards:  HDAC11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0006325	chromatin organization	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004407	histone deacetylase activity	IEA	molecular function
GO:0032041	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0014003	oligodendrocyte development	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0070932	histone H3 deacetylation	IEA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0016575	histone deacetylation	IDA	biological process
GO:0000118	histone deacetylase complex	IDA	cellular component
GO:0004407	histone deacetylase activity	IDA	molecular function
GO:0008134	transcription factor binding	TAS	molecular function
GO:0006325	chromatin organization	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05034	Alcoholism
hsa05203	Viral carcinogenesis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray