• Gene id: 79884

Gene Summary

• Gene Symbol: MAP9   Gene   UCSC   Ensembl
• Aliases: ASAP
• Gene name: microtubule associated protein 9
• Alternate names: microtubule-associated protein 9, aster-associated protein,
• Gene location: 4q32.1 (155376969: 155342657)     Exons: 14     NC_000004.12
• Gene summary(Entrez): ASAP is a microtubule-associated protein required for spindle function, mitotic progression, and cytokinesis (Saffin et al., 2005 [PubMed 16049101]).[supplied by OMIM, Mar 2008]
• OMIM: 610070

Protein Summary

• Protein general information: Q49MG5  
  • Name: Microtubule associated protein 9 (Aster associated protein)
  • Length: 647  
  • Mass: 74234
• Sequence:

  MSDEVFSTTLAYTKSPKVTKRTTFQDELIRAITARSARQRSSEYSDDFDSDEIVSLGDFSDTSADENSVNKKMND
  FHISDDEEKNPSKLLFLKTNKSNGNITKDEPVCAIKNEEEMAPDGCEDIVVKSFSESQNKDEEFEKDKIKMKPKP
  RILSIKSTSSAENNSLDTDDHFKPSPRPRSMLKKKSHMEEKDGLEDKETALSEELELHSAPSSLPTPNGIQLEAE
  KKAFSENLDPEDSCLTSLASSSLKQILGDSFSPGSEGNASGKDPNEEITENHNSLKSDENKENSFSADHVTTAVE
  KSKESQVTADDLEEEKAKAELIMDDDRTVDPLLSKSQSILISTSATASSKKTIEDRNIKNKKSTNNRASSASARL
  MTSEFLKKSSSKRRTPSTTTSSHYLGTLKVLDQKPSQKQSIEPDRADNIRAAVYQEWLEKKNVYLHEMHRIKRIE
  SENLRIQNEQKKAAKREEALASFEAWKAMKEKEAKKIAAKKRLEEKNKKKTEEENAARKGEALQAFEKWKEKKME
  YLKEKNRKEREYERAKKQKEEETVAEKKKDNLTAVEKWNEKKEAFFKQKEKEKINEKRKEELKRAEKKDKDKQAI
  NEYEKWLENKEKQERIERKQKKRHSFLESEALPPWSPPSRTVFAKVF

• Structural information:
  • Interpro: IPR026106  
  • STRING: ENSP00000310593
• Other Databases: GeneCards:  MAP9  Malacards:  MAP9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030424	axon	ISS	cellular component
GO:1990023	mitotic spindle midzone	IBA	cellular component
GO:1902412	regulation of mitotic cytokinesis	IBA	biological process
GO:0090307	mitotic spindle assembly	IBA	biological process
GO:0008017	microtubule binding	IBA	molecular function
GO:0000235	astral microtubule	IBA	cellular component
GO:0000281	mitotic cytokinesis	IEA	biological process
GO:0051225	spindle assembly	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005874	microtubule	IEA	cellular component
GO:0005818	aster	IEA	cellular component
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0090307	mitotic spindle assembly	IEA	biological process
GO:1990023	mitotic spindle midzone	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0000235	astral microtubule	IEA	cellular component
GO:0072686	mitotic spindle	IEA	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0072686	mitotic spindle	IDA	cellular component
GO:0000235	astral microtubule	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0051233	spindle midzone	IDA	cellular component
GO:0090307	mitotic spindle assembly	IDA	biological process
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0046602	regulation of mitotic centrosome separation	IMP	biological process
GO:1902412	regulation of mitotic cytokinesis	IMP	biological process
GO:0008017	microtubule binding	IMP	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881