• Gene id: 79882

Gene Summary

• Gene Symbol: ZC3H14   Gene   UCSC   Ensembl
• Aliases: MRT56, MSUT-2, NY-REN-37, SUT2, UKp68
• Gene name: zinc finger CCCH-type containing 14
• Alternate names: zinc finger CCCH domain-containing protein 14, mammalian suppressor of tau pathology-2, nuclear protein UKp68, renal carcinoma antigen NY-REN-37,
• Gene location: 14q31.3 (23690860: 23699175)     Exons: 13     NC_000022.11
• Gene summary(Entrez): The protein encoded by this gene is a poly(A)-binding protein that can affect gene expression and poly(A) tail length. The encoded protein may influence mRNA stability, nuclear export, and translation. [provided by RefSeq, May 2016]
• OMIM: 613279

Protein Summary

• Protein general information: Q6PJT7  
  • Name: Zinc finger CCCH domain containing protein 14 (Mammalian suppressor of tau pathology 2) (MSUT 2) (Renal carcinoma antigen NY REN 37)
  • Length: 736  
  • Mass: 82876
  • Tissue specificity: Isoform 1 and isoform 6 are expressed in fetal and adult brain. Isoform 1 and isoform 6 are expressed in fetal and adult temporal lobe. {ECO
• Sequence:

  MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTIRFTVWLHGVLDKLRS
  VTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIPSARPEKRDSRVSTSSQESKTTNVRQTYDDG
  AATRLMSTVKPLREPAPSEDVIDIKPEPDDLIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADS
  GVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVS
  SVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAISEAQESVTKTTNYSTV
  PQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGDSVEKNQGTQQRQLLSRLQIDPVMAETLQMS
  QDYYDMESMVHADTRSFILKKPKLSEEVVVAPNQESGMKTADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGV
  PSPPGYMSDQEEDMCFEGMKPVNQTAASNKGLRGLLHPQQLHLLSRQLEDPNGSFSNAEMSELSVAQKPEKLLER
  CKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPAVAPPAP
  PSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE

• Structural information:
  • Interpro: IPR040366  IPR000571  
  • Prosite: PS50103
  • STRING: ENSP00000251038
• Other Databases: GeneCards:  ZC3H14  Malacards:  ZC3H14

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043488	regulation of mRNA stability	IBA	biological process
GO:1900364	negative regulation of mRNA polyadenylation	IBA	biological process
GO:0008143	poly(A) binding	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0003723	RNA binding	IBA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0043488	regulation of mRNA stability	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0008143	poly(A) binding	IEA	molecular function
GO:1900364	negative regulation of mRNA polyadenylation	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:1990904	ribonucleoprotein complex	IDA	cellular component
GO:1904115	axon cytoplasm	IDA	cellular component
GO:0032839	dendrite cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016607	nuclear speck	IEA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Autosomal recessive mental retardation	KEGG:H00768
Autosomal recessive mental retardation	KEGG:H00768
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R