• Gene id: 79869

Gene Summary

• Gene Symbol: CPSF7   Gene   UCSC   Ensembl
• Aliases: CFIm59
• Gene name: cleavage and polyadenylation specific factor 7
• Alternate names: cleavage and polyadenylation specificity factor subunit 7, CPSF 59 kDa subunit, cleavage and polyadenylation specificity factor 59 kDa subunit, cleavage factor Im complex 59 kDa subunit, pre-mRNA cleavage factor I, 59 kDa subunit, pre-mRNA cleavage factor Im 5,
• Gene location: 11q12.2 (61429974: 61402650)     Exons: 2     NC_000011.10
• Gene summary(Entrez): Cleavage factor Im (CFIm) is one of six factors necessary for correct cleavage and polyadenylation of pre-mRNAs. CFIm is composed of three different subunits of 25, 59, and 68 kDa, and it functions as a heterotetramer, with a dimer of the 25 kDa subunit b

Protein Summary

• Protein general information: Q8N684  
  • Name: Cleavage and polyadenylation specificity factor subunit 7 (Cleavage and polyadenylation specificity factor 59 kDa subunit) (CPSF 59 kDa subunit) (Cleavage factor Im complex 59 kDa subunit) (CFIm59) (Pre mRNA cleavage factor Im 59 kDa subunit)
  • Length: 471  
  • Mass: 52050
• Sequence:

  MSEGVDLIDIYADEEFNQDPEFNNTDQIDLYDDVLTATSQPSDDRSSSTEPPPPVRQEPSPKPNNKTPAILYTYS
  GLRNRRAAVYVGSFSWWTTDQQLIQVIRSIGVYDVVELKFAENRANGQSKGYAEVVVASENSVHKLLELLPGKVL
  NGEKVDVRPATRQNLSQFEAQARKRECVRVPRGGIPPRAHSRDSSDSADGRATPSENLVPSSARVDKPPSVLPYF
  NRPPSALPLMGLPPPPIPPPPPLSSSFGVPPPPPGIHYQHLMPPPPRLPPHLAVPPPGAIPPALHLNPAFFPPPN
  ATVGPPPDTYMKASAPYNHHGSRDSGPPPSTVSEAEFEDIMKRNRAISSSAISKAVSGASAGDYSDAIETLLTAI
  AVIKQSRVANDERCRVLISSLKDCLHGIEAKSYSVGASGSSSRKRHRSRERSPSRSRESSRRHRDLLHNEDRHDD
  YFQERNREHERHRDRERDRHH

• Structural information:
  • Protein Domains: (82..16-)
    (/note="RRM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR034772  IPR034770  IPR034773  IPR012677  IPR035979   IPR000504  
  • Prosite: PS50102
  • CDD: cd12644
  • PDB: 3N9U
  • PDBsum: 3N9U
  • STRING: ENSP00000345412
• Other Databases: GeneCards:  CPSF7  Malacards:  CPSF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:1990120	messenger ribonucleoprotein complex assembly	IDA	biological process
GO:0005849	mRNA cleavage factor complex	IDA	cellular component
GO:0051262	protein tetramerization	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051290	protein heterotetramerization	IDA	biological process
GO:0005847	mRNA cleavage and polyadenylation specificity factor complex	IDA	cellular component
GO:0110104	mRNA alternative polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098789	pre-mRNA cleavage required for polyadenylation	IMP	biological process
GO:0098789	pre-mRNA cleavage required for polyadenylation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005849	mRNA cleavage factor complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0006369	termination of RNA polymerase II transcription	TAS	biological process
GO:0000398	mRNA splicing, via spliceosome	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0031124	mRNA 3'-end processing	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03015	mRNA surveillance pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)