• Gene id: 79866

Gene Summary

• Gene Symbol: BORA   Gene   UCSC   Ensembl
• Aliases: C13orf34
• Gene name: BORA aurora kinase A activator
• Alternate names: protein aurora borealis,
• Gene location: 13q21.33 (72727748: 72756197)     Exons: 12     NC_000013.11
• Gene summary(Entrez): BORA is an activator of the protein kinase Aurora A (AURKA; MIM 603072), which is required for centrosome maturation, spindle assembly, and asymmetric protein localization during mitosis (Hutterer et al., 2006 [PubMed 16890155]).[supplied by OMIM, Mar 200
• OMIM: 610510

Protein Summary

• Protein general information: Q6PGQ7  
  • Name: Protein aurora borealis (HsBora)
  • Length: 559  
  • Mass: 61203
• Sequence:

  MGDVKESKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSVFKSTKLPTPGKFRWSIDQLAVINPVEIDPED
  IHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGKQLSQCHSSKCTNINSDSPVGKKLTIHSEKS
  DAACQTLLSLPVDFNLENILGDYFRADEFADQSPGNLSSSSLRRKLFLDGNGSISDSLPSASPGSPHSGVQTSLE
  MFYSIDLSPVKCRSPLQTPSSGQFSSSPIQASAKKYSLGSITSPSPISSPTFSPIEFQIGETPLSEQRKFTVHSP
  DASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQIPFTLETQGEDEEDKENIPSTDVSS
  PAMDAAGIHLRQFSNEASTHGTHLVVTAMSVTQNQSSASEKELALLQDVEREKDNNTVDMVDPIEIADETTWIKE
  PVDNGSLPMTDFVSGIAFSIENSHMCMSPLAESSVIPCESSNIQMDSGYNTQNCGSNIMDTVGAESYCKESDAQT
  CEVESKSQAFNMKQDHTTQRCWMKTASPFQCSSP

• Structural information:
  • Interpro: IPR023252  
  • DIP: 53424
  • STRING: ENSP00000479266
• Other Databases: GeneCards:  BORA  Malacards:  BORA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072687	meiotic spindle	IBA	colocalizes with
GO:0060236	regulation of mitotic spindle organization	IBA	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0007088	regulation of mitotic nuclear division	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0060236	regulation of mitotic spindle organization	IMP	biological process
GO:0032880	regulation of protein localization	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0007088	regulation of mitotic nuclear division	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051301	cell division	IEA	biological process
GO:0007049	cell cycle	IEA	biological process
GO:0000086	G2/M transition of mitotic cell cycle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881