• Gene id: 79858

Gene Summary

• Gene Symbol: NEK11   Gene   UCSC   Ensembl
• Gene name: NIMA related kinase 11
• Alternate names: serine/threonine-protein kinase Nek11, NIMA (never in mitosis gene a)- related kinase 11,
• Gene location: 3q22.1 (112561319: 112585578)     Exons: 9     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the never in mitosis gene A family of kinases. The encoded protein localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. The encoded protein appears to play roles in DNA replication and response to
• OMIM: 609779

Protein Summary

• Protein general information: Q8NG66  
  • Name: Serine/threonine protein kinase Nek11 (EC 2.7.11.1) (Never in mitosis A related kinase 11) (NimA related protein kinase 11)
  • Length: 645  
  • Mass: 74192
  • Tissue specificity: Poorly expressed in cerebellum, trachea, lung, appendix, and uterus. {ECO
• Sequence:

  MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNPNETVQ
  ANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMH
  ERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYDTKSDIWSLACILYEM
  CCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIEILKIPYLDEQLQNLMCRYSE
  MTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKLQAADEKARKLKKIVEEKYEENSKRM
  QELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDEERWQGREEESDEPTLENLPESQPIPSMDLH
  ELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEESDEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIE
  ALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFNSVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNAS
  EAEIRECLEKVVPQASDCFEVDQLLYFEEQLLITMGKEPTLQNHL

• Structural information:
  • Protein Domains: (29..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR008271  
  • Prosite: PS50011 PS00108
  • STRING: ENSP00000372857
• Other Databases: GeneCards:  NEK11  Malacards:  NEK11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1901990	regulation of mitotic cell cycle phase transition	IMP	biological process
GO:0016572	histone phosphorylation	IMP	biological process
GO:0005654	nucleoplasm	IBA	cellular component
GO:0005813	centrosome	IBA	cellular component
GO:1901990	regulation of mitotic cell cycle phase transition	IBA	biological process
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0007059	chromosome segregation	IBA	biological process
GO:0031573	intra-S DNA damage checkpoint	IBA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0007049	cell cycle	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0031573	intra-S DNA damage checkpoint	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0005730	nucleolus	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R