• Gene id: 79856

Gene Summary

• Gene Symbol: SNX22   Gene   UCSC   Ensembl
• Gene name: sorting nexin 22
• Alternate names: sorting nexin-22,
• Gene location: 15q22.31 (64151697: 64157480)     Exons: 7     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene is a sorting nexin that is found in the cytoplasm, where it interacts with membrane-bound phosphatidylinositol 3-phosphate. The encoded protein may play a role in intracellular trafficking. Two transcript variants, one pro

Protein Summary

• Protein general information: Q96L94  
  • Name: Sorting nexin 22
  • Length: 193  
  • Mass: 22068
• Sequence:

  MLEVHIPSVGPEAEGPRQSPEKSHMVFRVEVLCSGRRHTVPRRYSEFHALHKRIKKLYKVPDFPSKRLPNWRTRG
  LEQRRQGLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFHVDPYVCN
  PSPESLPNVVVNGVLQGLYSFSISPDKAQPKAACHPAPLPPMP

• Structural information:
  • Protein Domains: (1..11-)
    (/note="PX-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00147"-)
  • Interpro: IPR001683  IPR036871  
  • Prosite: PS50195
  • PDB: 2ETT
  • PDBsum: 2ETT
  • STRING: ENSP00000323435
• Other Databases: GeneCards:  SNX22  Malacards:  SNX22

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035091	phosphatidylinositol binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 29961538

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
29961538	Male factor infertility			318 (128 couples presenting with OAT (MF) and 118 maternal age-matched control (no MF) subjects undergoing infertility treatment, 72 surplus cryopreserved blastocysts)	Male infertility	RNA-seq