• Gene id: 79853

Gene Summary

• Gene Symbol: TM4SF20   Gene   UCSC   Ensembl
• Aliases: PRO994, SLI5, TCCE518
• Gene name: transmembrane 4 L six family member 20
• Alternate names: transmembrane 4 L6 family member 20,
• Gene location: 2q36.3 (227379305: 227362037)     Exons: 5     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the four-transmembrane L6 superfamily. Members of this family function in various cellular processes including cell proliferation, motility, and adhesion via their interactions with integrins. In human brain

Protein Summary

• Protein general information: Q53R12  
  • Name: Transmembrane 4 L6 family member 20
  • Length: 229  
  • Mass: 25075
  • Tissue specificity: Expressed in the brain, with high levels in the parietal lobe, hippocampus, pons, white matter and cerebellum. {ECO
• Sequence:

  MTCCEGWTSCNGFSLLVLLLLGVVLNAIPLIVSLVEEDQFSQNPISCFEWWFPGIIGAGLMAIPATTMSLTARKR
  ACCNNRTGMFLSSLFSVITVIGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDS
  CAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGLLLVGILEVLFGLSQIVIGFLGCLCGVSKRR
  SQIV

• Structural information:
  • Interpro: IPR008661  
  • STRING: ENSP00000303028
• Other Databases: GeneCards:  TM4SF20  Malacards:  TM4SF20

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IBA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0045861	negative regulation of proteolysis	IDA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R