• Gene id: 79845

Gene Summary

• Gene Symbol: RNF122   Gene   UCSC   Ensembl
• Gene name: ring finger protein 122
• Alternate names: RING finger protein 122,
• Gene location: 8p12 (33567127: 33547753)     Exons: 7     NC_000008.11
• Gene summary(Entrez): The encoded protein contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. The encoded protein is localized to the endoplasmic reticulum and golgi ap
• OMIM: 602356

Protein Summary

• Protein general information: Q9H9V4  
  • Name: RING finger protein 122
  • Length: 155  
  • Mass: 17475
  • Tissue specificity: Widely expressed in several tissues and cell lines. {ECO
• Sequence:

  MHPFQWCNGCFCGLGLVSTNKSCSMPPISFQDLPLNIYMVIFGTGIFVFMLSLIFCCYFISKLRNQAQSERYGYK
  EVVLKGDAKKLQLYGQTCAVCLEDFKGKDELGVLPCQHAFHRKCLVKWLEVRCVCPMCNKPIASPSEATQNIGIL
  LDELV

• Structural information:
  • Interpro: IPR001841  IPR013083  
  • Prosite: PS50089
  • STRING: ENSP00000256257
• Other Databases: GeneCards:  RNF122  Malacards:  RNF122

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0012505	endomembrane system	IBA	cellular component
GO:0061630	ubiquitin protein ligase activity	IBA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0010917	negative regulation of mitochondrial membrane potential	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0043065	positive regulation of apoptotic process	IDA	biological process
GO:0051865	protein autoubiquitination	IMP	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IMP	biological process
GO:0061630	ubiquitin protein ligase activity	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881