• Gene id: 79844

Gene Summary

• Gene Symbol: ZDHHC11   Gene   UCSC   Ensembl
• Aliases: ZNF399
• Gene name: zinc finger DHHC-type containing 11
• Alternate names: probable palmitoyltransferase ZDHHC11, DHHC-11, zinc finger DHHC domain-containing protein 11, zinc finger protein 399, zinc finger, DHHC domain containing 11,
• Gene location: 5p15.33 (863633: 795604)     Exons: 23     NC_000005.10
• OMIM: 608954

Protein Summary

• Protein general information: Q9H8X9  
  • Name: Probable palmitoyltransferase ZDHHC11 (EC 2.3.1.225) (Zinc finger DHHC domain containing protein 11) (DHHC 11) (Zinc finger protein 399)
  • Length: 412  
  • Mass: 45975
• Sequence:

  MDTRSGSQCSVTPEAILNNEKLVLPPRISRVNGWSLPLHYFQVVTWAVFVGLSSATFGIFIPFLPHAWKYIAYVV
  TGGIFSFHLVVHLIASCIDPADSNVRLMKNYSQPMPLFDRSKHAHVIQNQFCHLCKVTVNKKTKHCISCNKCVSG
  FDHHCKWINNCVGSRNYWFFFSTVASATAGMLCLIAILLYVLVQYLVNPGVLRTDPRYEDVKNMNTWLLFLPLFP
  VQVQTLIVVIIGMLVLLLDFLGLVHLGQLLIFHIYLKAKKMTTFEYLINNRKEESSKHQAVRKDPYVQMDKGVLQ
  QGAGALGSSAQGVKAKSSLLIHKHLCHFCTSVNQDGDSTAREGDEDPCPSALGAKARNSRLICRRLCQFSTRVHP
  DGGSMAQEADDAPSISTLGLQQETTEPMKTDSAESED

• Structural information:
  • Protein Domains: (125..17-)
    (/note="DHHC-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00067"-)
  • Interpro: IPR001594  
  • Prosite: PS50216
  • STRING: ENSP00000283441
• Other Databases: GeneCards:  ZDHHC11  Malacards:  ZDHHC11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005783	endoplasmic reticulum	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0018230	peptidyl-L-cysteine S-palmitoylation	IBA	biological process
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IBA	molecular function
GO:0006612	protein targeting to membrane	IBA	biological process
GO:0035591	signaling adaptor activity	IDA	molecular function
GO:0019706	protein-cysteine S-palmitoyltransferase activity	ISS	molecular function
GO:0018230	peptidyl-L-cysteine S-palmitoylation	ISS	biological process
GO:0010008	endosome membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0002230	positive regulation of defense response to virus by host	IMP	biological process
GO:0140374	antiviral innate immune response	IMP	biological process
GO:0016409	palmitoyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0019706	protein-cysteine S-palmitoyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R