• Gene id: 79829

Gene Summary

• Gene Symbol: NAA40   Gene   UCSC   Ensembl
• Aliases: NAT11, NatD, PATT1, hNatD
• Gene name: N-alpha-acetyltransferase 40, NatD catalytic subunit
• Alternate names: N-alpha-acetyltransferase 40, N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog, N-acetyltransferase 11 (GCN5-related, putative), N-alpha acetyl transferase 40, N-alpha-acetyltransferase D, natD catalytic subunit, protein acetyltransferase 1,
• Gene location: 11q13.1 (63938972: 63957321)     Exons: 10     NC_000011.10

Protein Summary

• Protein general information: Q86UY6  
  • Name: N alpha acetyltransferase 40 (EC 2.3.1.257) (N acetyltransferase 11) (N alpha acetyltransferase D) (NatD) (hNatD) (Protein acetyltransferase 1)
  • Length: 237  
  • Mass: 27194
  • Tissue specificity: Widely expressed; with the highest expression level in liver and the lowest expression in brain (at protein level). {ECO
• Sequence:

  MGRKSSKAKEKKQKRLEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFD
  LTKTNMQTMYEQSEWGWKDREKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKG
  LGKFLIQILQLMANSTQMKKVMLTVFKHNHGAYQFFREALQFEIDDSSPSMSGCCGEDCSYEILSRRTKFGDSHH
  SHAGGHCGGCCH

• Structural information:
  • Protein Domains: (63..21-)
    (/note="N-acetyltransferase-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00532"-)
  • Interpro: IPR016181  IPR000182  IPR039949  
  • Prosite: PS51186
  • PDB: 4U9V 4U9W
  • PDBsum: 4U9V 4U9W
  • DIP: 61383
  • STRING: ENSP00000367024
• Other Databases: GeneCards:  NAA40  Malacards:  NAA40

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006474	N-terminal protein amino acid acetylation	IBA	biological process
GO:0010485	H4 histone acetyltransferase activity	IBA	molecular function
GO:0043998	H2A histone acetyltransferase activity	IBA	molecular function
GO:0061187	regulation of ribosomal DNA heterochromatin assembly	IBA	biological process
GO:1990189	peptide-serine-N-acetyltransferase activity	IBA	molecular function
GO:0006474	N-terminal protein amino acid acetylation	IDA	biological process
GO:0010485	H4 histone acetyltransferase activity	IDA	molecular function
GO:1990189	peptide-serine-N-acetyltransferase activity	IDA	molecular function
GO:0043968	histone H2A acetylation	IDA	biological process
GO:0043967	histone H4 acetylation	IDA	biological process
GO:0043998	H2A histone acetyltransferase activity	IDA	molecular function
GO:0008080	N-acetyltransferase activity	IEA	molecular function
GO:0010485	H4 histone acetyltransferase activity	IEA	molecular function
GO:0043998	H2A histone acetyltransferase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq