• Gene id: 79827

Gene Summary

• Gene Symbol: CLMP   Gene   UCSC   Ensembl
• Aliases: ACAM, ASAM, CSBM, CSBS
• Gene name: CXADR like membrane protein
• Alternate names: CXADR-like membrane protein, CAR-like membrane protein, adipocyte-specific adhesion molecule, coxsackie- and adenovirus receptor-like membrane protein,
• Gene location: 11q24.1 (70302066: 70295975)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene encodes a type I transmembrane protein that is localized to junctional complexes between endothelial and epithelial cells and may have a role in cell-cell adhesion. Expression of this gene in white adipose tissue is implicated in adipocyte matur
• OMIM: 611693

Protein Summary

• Protein general information: Q9H6B4  
  • Name: CXADR like membrane protein (Adipocyte adhesion molecule) (Coxsackie and adenovirus receptor like membrane protein) (CAR like membrane protein)
  • Length: 373  
  • Mass: 41281
  • Tissue specificity: Predominantly expressed in epithelial cells within different tissues and in the white adipose tissue. Expressed at high levels in small intestine and placenta, at intermediate levels in the heart, skeletal muscle, colon, spleen, kidney
• Sequence:

  MSLLLLLLLVSYYVGTLGTHTEIKRVAEEKVTLPCHHQLGLPEKDTLDIEWLLTDNEGNQKVVITYSSRHVYNNL
  TEEQKGRVAFASNFLAGDASLQIEPLKPSDEGRYTCKVKNSGRYVWSHVILKVLVRPSKPKCELEGELTEGSDLT
  LQCESSSGTEPIVYYWQRIREKEGEDERLPPKSRIDYNHPGRVLLQNLTMSYSGLYQCTAGNEAGKESCVVRVTV
  QYVQSIGMVAGAVTGIVAGALLIFLLVWLLIRRKDKERYEEEERPNEIREDAEAPKARLVKPSSSSSGSRSSRSG
  SSSTRSTANSASRSQRTLSTDAAPQPGLATQAYSLVGPEVRGSEPKKVHHANLTKAETTPSMIPSQSRAFQTV

• Structural information:
  • Protein Domains: (19..12-)
    1 (/note="Ig-like-C2-type)
    (135..22-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR042454  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000405577
• Other Databases: GeneCards:  CLMP  Malacards:  CLMP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005923	bicellular tight junction	IDA	cellular component
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0048565	digestive tract development	IMP	biological process
GO:0005881	cytoplasmic microtubule	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	HDA	cellular component

Diseases

Associated diseases	References
Congenital short bowel syndrome	KEGG:H01477
Congenital short bowel syndrome	KEGG:H01477
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray