• Gene id: 7982

Gene Summary

• Gene Symbol: ST7   Gene   UCSC   Ensembl
• Aliases: ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7
• Gene name: suppression of tumorigenicity 7
• Alternate names: suppressor of tumorigenicity 7 protein, family with sequence similarity 4, subfamily A, member 1, suppression of tumorigenicity 7 (breast),
• Gene location: 7q31.2 (116953500: 117230175)     Exons: 21     NC_000007.14
• Gene summary(Entrez): The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutation
• OMIM: 600833

Protein Summary

• Protein general information: Q9NRC1  
  • Name: Suppressor of tumorigenicity 7 protein (Protein FAM4A1) (Protein HELG)
  • Length: 585  
  • Mass: 67166
  • Tissue specificity: Ubiquitously expressed, with highest levels in heart, liver and pancreas. {ECO
• Sequence:

  MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTPKFYVALTGTSSLISG
  LILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSNGDSDSNRQSVSECKVWRNPLNLFRGAEYNR
  YTWVTGREPLTYYDMNLSAQDHQTFFTCDSDHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIA
  SSTIWEIKLLPKCATAYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR
  RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDDISLPKSATICYTAAL
  LKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYAFFHLA
  HWKRVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSF
  TAMLALLTHQFPELMGVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN

• Structural information:
  • Interpro: IPR007311  IPR011990  
  • CDD: cd11557
  • STRING: ENSP00000265437
• Other Databases: GeneCards:  ST7  Malacards:  ST7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030198	extracellular matrix organization	NAS	biological process
GO:0045595	regulation of cell differentiation	NAS	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray