• Gene id: 79817

Gene Summary

• Gene Symbol: MOB3B   Gene   UCSC   Ensembl
• Aliases: C9orf35, MOB1D, MOBKL2B
• Gene name: MOB kinase activator 3B
• Alternate names: MOB kinase activator 3B, MOB kinase activator-like 2B, MOB1, Mps One Binder kinase activator-like 2B, mob1 homolog 2b, monopolar spindle 1 binding, MOB1, domain containing, mps one binder kinase activator-like 2B,
• Gene location: 9p21.2 (27529813: 27325208)     Exons: 4     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene shares similarity with the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. This gene is located on the opposite strand as the inte
• OMIM: 617652

Protein Summary

• Protein general information: Q86TA1  
  • Name: MOB kinase activator 3B (Mob1 homolog 2b) (Mps one binder kinase activator like 2B) (MOB kinase activator like 2B)
  • Length: 216  
  • Mass: 25464
• Sequence:

  MSIALKQVFNKDKTFRPKRKFEPGTQRFELHKRAQASLNSGVDLKAAVQLPSGEDQNDWVAVHVVDFFNRINLIY
  GTICEFCTERTCPVMSGGPKYEYRWQDDLKYKKPTALPAPQYMNLLMDWIEVQINNEEIFPTCVGVPFPKNFLQI
  CKKILCRLFRVFVHVYIHHFDRVIVMGAEAHVNTCYKHFYYFVTEMNLIDRKELEPLKEMTSRMCH

• Structural information:
  • Interpro: IPR005301  IPR036703  
  • STRING: ENSP00000262244
• Other Databases: GeneCards:  MOB3B  Malacards:  MOB3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0035330	regulation of hippo signaling	IMP	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq