• Gene id: 79814

Gene Summary

• Gene Symbol: AGMAT   Gene   UCSC   Ensembl
• Gene name: agmatinase
• Alternate names: agmatinase, mitochondrial, AUH, agmatine ureohydrolase (agmatinase),
• Gene location: 1p36.21 (90529914: 90645344)     Exons: 17     NC_000015.10
• OMIM: 617887

Protein Summary

• Protein general information: Q9BSE5  
  • Name: Agmatinase, mitochondrial (EC 3.5.3.11) (Agmatine ureohydrolase) (AUH)
  • Length: 352  
  • Mass: 37660
  • Tissue specificity: Highly expressed in liver and kidney. Also found in skeletal muscle, fetal liver, brain, testis, skin and the gastrointestinal tract. Within brain, expression is higher in the cerebral cortex with lower levels in the medulla and spinal
• Sequence:

  MLRLLASGCARGPGPGVGARPAAGLFHPGRRQSRQASDAPRNQPPSPEFVARPVGVCSMMRLPVQTSPEGLDAAF
  IGVPLDTGTSNRPGARFGPRRIREESVMLGTVNPSTGALPFQSLMVADLGDVNVNLYNLQDSCRRIQEAYEKIVA
  AGCIPLTLGGDHTITYPILQAMAKKHGPVGLLHVDAHTDTTDKALGEKLYHGAPFRRCVDEGLLDCKRVVQIGIR
  GSSTTLDPYRYNRSQGFRVVLAEDCWMKSLVPLMGEVRQQMGGKPIYISFDIDALDPAYAPGTGTPEIAGLTPSQ
  ALEIIRGCQGLNVMGCDLVEVSPPYDLSGNTALLAANLLFEMLCALPKVTTV

• Structural information:
  • Interpro: IPR005925  IPR006035  IPR023696  IPR020855  
  • Prosite: PS01053 PS51409
  • STRING: ENSP00000364986
• Other Databases: GeneCards:  AGMAT  Malacards:  AGMAT

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0033389	putrescine biosynthetic process from arginine, using agmatinase	IBA	biological process
GO:0008783	agmatinase activity	IBA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016813	hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amidines	IEA	molecular function
GO:0008295	spermidine biosynthetic process	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0009446	putrescine biosynthetic process	IEA	biological process
GO:0008783	agmatinase activity	IEA	molecular function
GO:0005739	mitochondrion	TAS	cellular component
GO:0097055	agmatine biosynthetic process	TAS	biological process
GO:0008783	agmatinase activity	TAS	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0033388	putrescine biosynthetic process from arginine	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)